Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4421497..4422154 | Replicon | chromosome |
| Accession | NZ_CP102546 | ||
| Organism | Klebsiella pneumoniae strain KPH1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NUG47_RS21825 | Protein ID | WP_002916310.1 |
| Coordinates | 4421744..4422154 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NUG47_RS21820 | Protein ID | WP_002916312.1 |
| Coordinates | 4421497..4421763 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG47_RS21795 (4416653) | 4416653..4418086 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| NUG47_RS21800 (4418205) | 4418205..4418933 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NUG47_RS21805 (4418983) | 4418983..4419294 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| NUG47_RS21810 (4419458) | 4419458..4420117 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| NUG47_RS21815 (4420268) | 4420268..4421251 | - | 984 | WP_004185555.1 | tRNA-modifying protein YgfZ | - |
| NUG47_RS21820 (4421497) | 4421497..4421763 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NUG47_RS21825 (4421744) | 4421744..4422154 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NUG47_RS21830 (4422161) | 4422161..4422682 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
| NUG47_RS21835 (4422783) | 4422783..4423679 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NUG47_RS21840 (4423702) | 4423702..4424415 | + | 714 | WP_004185548.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NUG47_RS21845 (4424421) | 4424421..4426154 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T253841 WP_002916310.1 NZ_CP102546:4421744-4422154 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |