Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3557243..3557868 | Replicon | chromosome |
Accession | NZ_CP102546 | ||
Organism | Klebsiella pneumoniae strain KPH1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NUG47_RS17545 | Protein ID | WP_040182550.1 |
Coordinates | 3557243..3557626 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NUG47_RS17550 | Protein ID | WP_004150355.1 |
Coordinates | 3557626..3557868 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG47_RS17530 (3554609) | 3554609..3555511 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NUG47_RS17535 (3555508) | 3555508..3556143 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NUG47_RS17540 (3556140) | 3556140..3557069 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NUG47_RS17545 (3557243) | 3557243..3557626 | - | 384 | WP_040182550.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUG47_RS17550 (3557626) | 3557626..3557868 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NUG47_RS17555 (3558073) | 3558073..3558990 | + | 918 | WP_023302328.1 | alpha/beta hydrolase | - |
NUG47_RS17560 (3559004) | 3559004..3559945 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NUG47_RS17565 (3559990) | 3559990..3560427 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NUG47_RS17570 (3560424) | 3560424..3561284 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NUG47_RS17575 (3561278) | 3561278..3561877 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14376.67 Da Isoelectric Point: 9.5352
>T253838 WP_040182550.1 NZ_CP102546:c3557626-3557243 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLKLITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|