Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2370241..2370860 Replicon chromosome
Accession NZ_CP102546
Organism Klebsiella pneumoniae strain KPH1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NUG47_RS11915 Protein ID WP_002892050.1
Coordinates 2370642..2370860 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NUG47_RS11910 Protein ID WP_002892066.1
Coordinates 2370241..2370615 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG47_RS11900 (2365393) 2365393..2366586 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NUG47_RS11905 (2366609) 2366609..2369755 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NUG47_RS11910 (2370241) 2370241..2370615 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NUG47_RS11915 (2370642) 2370642..2370860 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NUG47_RS11920 (2371023) 2371023..2371589 + 567 WP_002892030.1 maltose O-acetyltransferase -
NUG47_RS11925 (2371561) 2371561..2371701 - 141 WP_004147370.1 hypothetical protein -
NUG47_RS11930 (2371722) 2371722..2372192 + 471 WP_040182126.1 YlaC family protein -
NUG47_RS11935 (2372167) 2372167..2373618 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NUG47_RS11940 (2373719) 2373719..2374417 + 699 WP_002892021.1 GNAT family protein -
NUG47_RS11945 (2374414) 2374414..2374554 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NUG47_RS11950 (2374554) 2374554..2374817 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T253834 WP_002892050.1 NZ_CP102546:2370642-2370860 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT253834 WP_002892066.1 NZ_CP102546:2370241-2370615 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References