Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2438899..2439464 | Replicon | chromosome |
Accession | NZ_CP102542 | ||
Organism | Lacticaseibacillus rhamnosus strain GR-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | C2JYM4 |
Locus tag | NUU07_RS11205 | Protein ID | WP_005692155.1 |
Coordinates | 2438899..2439246 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NUU07_RS11210 | Protein ID | WP_020752297.1 |
Coordinates | 2439246..2439464 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUU07_RS11185 (NUU07_11180) | 2434516..2435757 | - | 1242 | WP_005692160.1 | acyltransferase | - |
NUU07_RS11190 (NUU07_11185) | 2435754..2436455 | - | 702 | WP_064522467.1 | ATP-binding cassette domain-containing protein | - |
NUU07_RS11195 (NUU07_11190) | 2436448..2437266 | - | 819 | WP_014571588.1 | ABC transporter permease subunit | - |
NUU07_RS11200 (NUU07_11195) | 2437507..2438175 | - | 669 | WP_005692157.1 | phenylalanine--tRNA ligase beta subunit-related protein | - |
NUU07_RS11205 (NUU07_11200) | 2438899..2439246 | - | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NUU07_RS11210 (NUU07_11205) | 2439246..2439464 | - | 219 | WP_020752297.1 | hypothetical protein | Antitoxin |
NUU07_RS11215 (NUU07_11210) | 2439558..2441393 | - | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein | - |
NUU07_RS11220 (NUU07_11215) | 2441380..2443170 | - | 1791 | WP_005692150.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T253826 WP_005692155.1 NZ_CP102542:c2439246-2438899 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|