Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
| Location | 2177417..2177906 | Replicon | chromosome |
| Accession | NZ_CP102541 | ||
| Organism | Bifidobacterium longum subsp. infantis strain BB-02 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NUU11_RS10200 | Protein ID | WP_229773994.1 |
| Coordinates | 2177417..2177644 (-) | Length | 76 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | A0A4V2N072 |
| Locus tag | NUU11_RS10205 | Protein ID | WP_032744823.1 |
| Coordinates | 2177670..2177906 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU11_RS10185 (NUU11_10185) | 2174640..2175362 | - | 723 | WP_060620046.1 | hypothetical protein | - |
| NUU11_RS10190 (NUU11_10190) | 2175427..2176383 | - | 957 | WP_212105731.1 | A/G-specific adenine glycosylase | - |
| NUU11_RS10195 (NUU11_10195) | 2176404..2177066 | + | 663 | WP_003828427.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| NUU11_RS10200 (NUU11_10200) | 2177417..2177644 | - | 228 | WP_229773994.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUU11_RS10205 (NUU11_10205) | 2177670..2177906 | - | 237 | WP_032744823.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| NUU11_RS10210 (NUU11_10210) | 2179213..2180538 | - | 1326 | WP_234932960.1 | MFS transporter | - |
| NUU11_RS10215 (NUU11_10215) | 2180566..2181753 | - | 1188 | WP_174774172.1 | carboxylate--amine ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 76 a.a. Molecular weight: 8653.22 Da Isoelectric Point: 10.1818
>T253824 WP_229773994.1 NZ_CP102541:c2177644-2177417 [Bifidobacterium longum subsp. infantis]
MKKLDRNVAKRIIAKLREISQLEDPRSTGKALAGNLAGLWRYRVGDYRIVCDIEDEVLLILVIDVAHRSKVYKRC
MKKLDRNVAKRIIAKLREISQLEDPRSTGKALAGNLAGLWRYRVGDYRIVCDIEDEVLLILVIDVAHRSKVYKRC
Download Length: 228 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|