Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-RelB |
| Location | 1652546..1653101 | Replicon | chromosome |
| Accession | NZ_CP102541 | ||
| Organism | Bifidobacterium longum subsp. infantis strain BB-02 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S2ZXD7 |
| Locus tag | NUU11_RS07735 | Protein ID | WP_003829109.1 |
| Coordinates | 1652778..1653101 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | NUU11_RS07730 | Protein ID | WP_212105461.1 |
| Coordinates | 1652546..1652791 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU11_RS07710 (NUU11_07710) | 1648373..1649035 | + | 663 | WP_019728044.1 | TetR/AcrR family transcriptional regulator | - |
| NUU11_RS07715 (NUU11_07715) | 1649192..1650463 | + | 1272 | WP_025341702.1 | MFS transporter | - |
| NUU11_RS07720 (NUU11_07720) | 1650647..1650796 | - | 150 | WP_234933099.1 | XRE family transcriptional regulator | - |
| NUU11_RS07725 (NUU11_07725) | 1651116..1652372 | - | 1257 | WP_212105458.1 | HipA domain-containing protein | - |
| NUU11_RS07730 (NUU11_07730) | 1652546..1652791 | + | 246 | WP_212105461.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NUU11_RS07735 (NUU11_07735) | 1652778..1653101 | + | 324 | WP_003829109.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NUU11_RS07740 (NUU11_07740) | 1653318..1653932 | - | 615 | WP_195338371.1 | cupin domain-containing protein | - |
| NUU11_RS07745 (NUU11_07745) | 1654027..1654896 | - | 870 | WP_212105464.1 | class I SAM-dependent methyltransferase | - |
| NUU11_RS07750 (NUU11_07750) | 1655134..1655499 | + | 366 | WP_032743659.1 | YccF domain-containing protein | - |
| NUU11_RS07755 (NUU11_07755) | 1656042..1657307 | + | 1266 | WP_212105467.1 | Fic family protein | - |
| NUU11_RS07760 (NUU11_07760) | 1657777..1658075 | + | 299 | Protein_1509 | IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11859.67 Da Isoelectric Point: 5.0771
>T253823 WP_003829109.1 NZ_CP102541:1652778-1653101 [Bifidobacterium longum subsp. infantis]
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MKRGEIWTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|