Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
Location | 1594256..1594895 | Replicon | chromosome |
Accession | NZ_CP102541 | ||
Organism | Bifidobacterium longum subsp. infantis strain BB-02 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NUU11_RS07450 | Protein ID | WP_212105396.1 |
Coordinates | 1594539..1594895 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NUU11_RS07445 | Protein ID | WP_003829235.1 |
Coordinates | 1594256..1594552 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUU11_RS07420 (NUU11_07420) | 1589647..1592325 | - | 2679 | WP_212105390.1 | alanine--tRNA ligase | - |
NUU11_RS07425 (NUU11_07425) | 1592454..1592690 | - | 237 | WP_029679572.1 | hypothetical protein | - |
NUU11_RS07430 (NUU11_07430) | 1592690..1593088 | - | 399 | WP_012577919.1 | DUF948 domain-containing protein | - |
NUU11_RS07435 (NUU11_07435) | 1593171..1593845 | - | 675 | WP_212105393.1 | histidine phosphatase family protein | - |
NUU11_RS07440 (NUU11_07440) | 1593921..1594109 | + | 189 | WP_234933089.1 | hypothetical protein | - |
NUU11_RS07445 (NUU11_07445) | 1594256..1594552 | + | 297 | WP_003829235.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NUU11_RS07450 (NUU11_07450) | 1594539..1594895 | + | 357 | WP_212105396.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NUU11_RS07455 (NUU11_07455) | 1595353..1595688 | - | 336 | WP_234933091.1 | transglutaminase family protein | - |
NUU11_RS07460 (NUU11_07460) | 1595793..1596026 | - | 234 | WP_248315138.1 | hypothetical protein | - |
NUU11_RS07465 (NUU11_07465) | 1596043..1596432 | + | 390 | WP_234933093.1 | cytidine deaminase | - |
NUU11_RS07470 (NUU11_07470) | 1596570..1597352 | + | 783 | WP_212105399.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
NUU11_RS07475 (NUU11_07475) | 1597690..1598316 | - | 627 | WP_007052130.1 | 30S ribosomal protein S4 | - |
NUU11_RS07480 (NUU11_07480) | 1598515..1599507 | - | 993 | WP_212105402.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13315.26 Da Isoelectric Point: 7.9984
>T253822 WP_212105396.1 NZ_CP102541:1594539-1594895 [Bifidobacterium longum subsp. infantis]
MMKTDPRQFEIWWVPFAFPDKPGKAKNHPSVILQWDDGTRIALMTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
MMKTDPRQFEIWWVPFAFPDKPGKAKNHPSVILQWDDGTRIALMTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|