Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1045237..1045820 | Replicon | chromosome |
Accession | NZ_CP102541 | ||
Organism | Bifidobacterium longum subsp. infantis strain BB-02 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A1S2VZ23 |
Locus tag | NUU11_RS04800 | Protein ID | WP_032745284.1 |
Coordinates | 1045518..1045820 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | I3AVV5 |
Locus tag | NUU11_RS04795 | Protein ID | WP_007057517.1 |
Coordinates | 1045237..1045521 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUU11_RS04775 (NUU11_04775) | 1041743..1042825 | + | 1083 | Protein_923 | transposase | - |
NUU11_RS04780 (NUU11_04780) | 1042923..1043831 | + | 909 | WP_193641239.1 | ABC transporter ATP-binding protein | - |
NUU11_RS04785 (NUU11_04785) | 1043828..1044559 | + | 732 | WP_032744305.1 | ABC transporter permease | - |
NUU11_RS04790 (NUU11_04790) | 1044577..1045128 | - | 552 | Protein_926 | IS30 family transposase | - |
NUU11_RS04795 (NUU11_04795) | 1045237..1045521 | - | 285 | WP_007057517.1 | putative addiction module antidote protein | Antitoxin |
NUU11_RS04800 (NUU11_04800) | 1045518..1045820 | - | 303 | WP_032745284.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUU11_RS04805 (NUU11_04805) | 1045858..1046187 | - | 330 | WP_257798116.1 | DUF1922 domain-containing protein | - |
NUU11_RS04810 (NUU11_04810) | 1046313..1046801 | + | 489 | WP_032745281.1 | D-aminoacyl-tRNA deacylase | - |
NUU11_RS04815 (NUU11_04815) | 1046962..1050081 | + | 3120 | WP_212104835.1 | alpha-mannosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1038045..1048898 | 10853 | |
- | flank | IS/Tn | - | - | 1044577..1045032 | 455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11350.08 Da Isoelectric Point: 10.4626
>T253820 WP_032745284.1 NZ_CP102541:c1045820-1045518 [Bifidobacterium longum subsp. infantis]
IKQSAEYRKWFKKLRDHKAKAAIQARLDACKLAGRPFGDIKPVGGPVSEMRFHTGAGYRVYFAMQGNVLMLLLAGGDKST
QQTDIRQAHDILNDYKEQRQ
IKQSAEYRKWFKKLRDHKAKAAIQARLDACKLAGRPFGDIKPVGGPVSEMRFHTGAGYRVYFAMQGNVLMLLLAGGDKST
QQTDIRQAHDILNDYKEQRQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2VZ23 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I3AVV5 |