Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 1231101..1231667 Replicon chromosome
Accession NZ_CP102536
Organism Bifidobacterium breve strain BIF195

Toxin (Protein)


Gene name relE Uniprot ID A0A0L7AXF3
Locus tag NUU00_RS05325 Protein ID WP_025262990.1
Coordinates 1231374..1231667 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0L7AY16
Locus tag NUU00_RS05320 Protein ID WP_025262989.1
Coordinates 1231101..1231370 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUU00_RS05295 (NUU00_05295) 1226850..1227536 - 687 WP_013140734.1 response regulator transcription factor -
NUU00_RS05300 (NUU00_05300) 1227668..1228186 + 519 WP_223261719.1 hypothetical protein -
NUU00_RS05305 (NUU00_05305) 1228183..1229073 + 891 WP_025262987.1 hypothetical protein -
NUU00_RS05310 (NUU00_05310) 1229070..1229750 + 681 WP_003829413.1 ABC transporter ATP-binding protein -
NUU00_RS05315 (NUU00_05315) 1229756..1230916 + 1161 WP_038426914.1 ABC transporter permease -
NUU00_RS05320 (NUU00_05320) 1231101..1231370 + 270 WP_025262989.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NUU00_RS05325 (NUU00_05325) 1231374..1231667 + 294 WP_025262990.1 type II toxin-antitoxin system YafQ family toxin Toxin
NUU00_RS05330 (NUU00_05330) 1231673..1231972 - 300 WP_025262991.1 hypothetical protein -
NUU00_RS05335 (NUU00_05335) 1232010..1232138 + 129 WP_003829419.1 hypothetical protein -
NUU00_RS05340 (NUU00_05340) 1232358..1232885 + 528 WP_025262992.1 RNA polymerase sigma factor -
NUU00_RS05345 (NUU00_05345) 1232919..1233746 + 828 WP_015438835.1 hypothetical protein -
NUU00_RS05350 (NUU00_05350) 1233878..1234504 + 627 WP_025262993.1 hypothetical protein -
NUU00_RS05355 (NUU00_05355) 1234501..1235283 + 783 WP_025262994.1 hypothetical protein -
NUU00_RS05360 (NUU00_05360) 1235336..1236211 + 876 WP_021649674.1 ABC transporter ATP-binding protein -
NUU00_RS05365 (NUU00_05365) 1236266..1236664 + 399 WP_015438839.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1225006..1250522 25516


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-95)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(3-87)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11190.93 Da        Isoelectric Point: 9.7881

>T253818 WP_025262990.1 NZ_CP102536:1231374-1231667 [Bifidobacterium breve]
MLKPDYTAAFQRDIKKLKRKHTDLRPLKEVIRLVLEDTADSKEALRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK

Download         Length: 294 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 9860.12 Da        Isoelectric Point: 4.5742

>AT253818 WP_025262989.1 NZ_CP102536:1231101-1231370 [Bifidobacterium breve]
VSMASVTVRVDADTKQKAANIAEDLGLDLSSVTRAFYKQIVRERRIPLNLSYTTVPPETMEALDEAKNRLADGQPRFNSA
DEMFDSLGI

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0L7AXF3

Antitoxin

Source ID Structure
AlphaFold DB A0A0L7AY16

References