Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
| Location | 1043721..1044360 | Replicon | chromosome |
| Accession | NZ_CP102536 | ||
| Organism | Bifidobacterium breve strain BIF195 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D4BP71 |
| Locus tag | NUU00_RS04435 | Protein ID | WP_003829234.1 |
| Coordinates | 1043721..1044077 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | NUU00_RS04440 | Protein ID | WP_003829235.1 |
| Coordinates | 1044064..1044360 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU00_RS04405 (NUU00_04405) | 1038908..1039819 | + | 912 | WP_003829224.1 | ABC transporter ATP-binding protein | - |
| NUU00_RS04410 (NUU00_04410) | 1040016..1040642 | + | 627 | WP_003829226.1 | 30S ribosomal protein S4 | - |
| NUU00_RS04415 (NUU00_04415) | 1040979..1041761 | - | 783 | WP_015438747.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| NUU00_RS04420 (NUU00_04420) | 1041907..1042392 | - | 486 | WP_003829229.1 | cytidine deaminase | - |
| NUU00_RS04425 (NUU00_04425) | 1042481..1042837 | + | 357 | WP_003829232.1 | SdpI family protein | - |
| NUU00_RS04430 (NUU00_04430) | 1042942..1043544 | + | 603 | WP_003829233.1 | transglutaminase family protein | - |
| NUU00_RS04435 (NUU00_04435) | 1043721..1044077 | - | 357 | WP_003829234.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NUU00_RS04440 (NUU00_04440) | 1044064..1044360 | - | 297 | WP_003829235.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NUU00_RS04445 (NUU00_04445) | 1044508..1044672 | - | 165 | Protein_862 | IS30 family transposase | - |
| NUU00_RS04450 (NUU00_04450) | 1044772..1045446 | + | 675 | WP_025262941.1 | histidine phosphatase family protein | - |
| NUU00_RS04455 (NUU00_04455) | 1045529..1045933 | + | 405 | WP_003829238.1 | DUF948 domain-containing protein | - |
| NUU00_RS04460 (NUU00_04460) | 1045933..1046169 | + | 237 | WP_003829239.1 | hypothetical protein | - |
| NUU00_RS04465 (NUU00_04465) | 1046265..1048943 | + | 2679 | WP_003829240.1 | alanine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13316.23 Da Isoelectric Point: 7.9984
>T253817 WP_003829234.1 NZ_CP102536:c1044077-1043721 [Bifidobacterium breve]
MMKTDPHQFEIWWVPFTFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSSLFLDDGPTGRLSAYDAGRVTWAINELYPGLLA
MMKTDPHQFEIWWVPFTFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSSLFLDDGPTGRLSAYDAGRVTWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|