Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-RelB |
| Location | 984404..984959 | Replicon | chromosome |
| Accession | NZ_CP102536 | ||
| Organism | Bifidobacterium breve strain BIF195 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | B7GSS5 |
| Locus tag | NUU00_RS04155 | Protein ID | WP_003833460.1 |
| Coordinates | 984404..984727 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S2ZDC4 |
| Locus tag | NUU00_RS04160 | Protein ID | WP_003829112.1 |
| Coordinates | 984714..984959 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU00_RS04130 (NUU00_04130) | 979441..979729 | - | 289 | Protein_799 | IS256 family transposase | - |
| NUU00_RS04135 (NUU00_04135) | 980200..981465 | - | 1266 | WP_025262925.1 | Fic family protein | - |
| NUU00_RS04140 (NUU00_04140) | 982007..982372 | - | 366 | WP_013140585.1 | YccF domain-containing protein | - |
| NUU00_RS04145 (NUU00_04145) | 982610..983479 | + | 870 | WP_003829104.1 | class I SAM-dependent methyltransferase | - |
| NUU00_RS04150 (NUU00_04150) | 983573..984187 | + | 615 | WP_003829107.1 | cupin domain-containing protein | - |
| NUU00_RS04155 (NUU00_04155) | 984404..984727 | - | 324 | WP_003833460.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NUU00_RS04160 (NUU00_04160) | 984714..984959 | - | 246 | WP_003829112.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NUU00_RS04165 (NUU00_04165) | 985133..986389 | + | 1257 | WP_003829116.1 | HipA domain-containing protein | - |
| NUU00_RS04170 (NUU00_04170) | 986654..986845 | + | 192 | WP_003829118.1 | hypothetical protein | - |
| NUU00_RS04175 (NUU00_04175) | 987029..988300 | - | 1272 | WP_003829121.1 | MFS transporter | - |
| NUU00_RS04180 (NUU00_04180) | 988457..989119 | - | 663 | WP_025262926.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 974174..1022459 | 48285 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11829.64 Da Isoelectric Point: 6.2932
>T253816 WP_003833460.1 NZ_CP102536:c984727-984404 [Bifidobacterium breve]
MKRGEIRTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
MKRGEIRTLQADGYASKPRPVVIVQSDAVDRFDSVITCLLTSYDSSDIDTRVRLEPSPENGLNKVSYVMTDKIVTVDRKL
LGYQVGVVDDAAMANIGRQLMRVLGLL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4R0SL31 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A087B6Q6 |