Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 359630..360201 | Replicon | chromosome |
| Accession | NZ_CP102534 | ||
| Organism | Enterococcus faecium strain ENCfa-68 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R2Q2D5 |
| Locus tag | NUU03_RS01745 | Protein ID | WP_002341043.1 |
| Coordinates | 359860..360201 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A2A4E1M8 |
| Locus tag | NUU03_RS01740 | Protein ID | WP_025477367.1 |
| Coordinates | 359630..359860 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU03_RS01720 (NUU03_01705) | 355894..356487 | + | 594 | WP_002342793.1 | malonate decarboxylase holo-ACP synthase | - |
| NUU03_RS01725 (NUU03_01710) | 356511..357596 | + | 1086 | WP_002342794.1 | acyltransferase family protein | - |
| NUU03_RS01730 (NUU03_01715) | 357618..358487 | + | 870 | WP_002342795.1 | triphosphoribosyl-dephospho-CoA synthase MdcB | - |
| NUU03_RS01735 (NUU03_01720) | 358599..359363 | + | 765 | WP_002341045.1 | TIM44-like domain-containing protein | - |
| NUU03_RS01740 (NUU03_01725) | 359630..359860 | + | 231 | WP_025477367.1 | hypothetical protein | Antitoxin |
| NUU03_RS01745 (NUU03_01730) | 359860..360201 | + | 342 | WP_002341043.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NUU03_RS01750 | 360381..360740 | + | 360 | WP_156238084.1 | hypothetical protein | - |
| NUU03_RS01755 (NUU03_01735) | 360917..362998 | + | 2082 | WP_002342796.1 | PTS sugar transporter subunit IIA | - |
| NUU03_RS01760 (NUU03_01740) | 363034..363336 | + | 303 | Protein_351 | PTS sugar transporter subunit IIB | - |
| NUU03_RS01765 (NUU03_01745) | 363362..364651 | + | 1290 | WP_002341041.1 | PTS sugar transporter subunit IIC | - |
| NUU03_RS01770 (NUU03_01750) | 364670..365077 | + | 408 | Protein_353 | tetratricopeptide repeat protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13316.66 Da Isoelectric Point: 9.9258
>T253814 WP_002341043.1 NZ_CP102534:359860-360201 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVLISQ
LKSLDFKERRLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVLISQ
LKSLDFKERRLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829AD04 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A4E1M8 |