Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 2679130..2679781 | Replicon | chromosome |
| Accession | NZ_CP102530 | ||
| Organism | Lacticaseibacillus paracasei subsp. paracasei strain 01 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | K6S8L5 |
| Locus tag | NUU02_RS13205 | Protein ID | WP_003567661.1 |
| Coordinates | 2679130..2679513 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | K0NCT7 |
| Locus tag | NUU02_RS13210 | Protein ID | WP_014566665.1 |
| Coordinates | 2679533..2679781 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUU02_RS13200 (NUU02_13200) | 2678435..2678956 | - | 522 | WP_012492007.1 | QueT transporter family protein | - |
| NUU02_RS13205 (NUU02_13205) | 2679130..2679513 | - | 384 | WP_003567661.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NUU02_RS13210 (NUU02_13210) | 2679533..2679781 | - | 249 | WP_014566665.1 | antitoxin | Antitoxin |
| NUU02_RS13215 (NUU02_13215) | 2679849..2680985 | - | 1137 | WP_003576478.1 | alanine racemase | - |
| NUU02_RS13220 (NUU02_13220) | 2680972..2681346 | - | 375 | WP_003567669.1 | holo-ACP synthase | - |
| NUU02_RS13225 (NUU02_13225) | 2681516..2683024 | - | 1509 | WP_003567670.1 | DEAD/DEAH box helicase | - |
| NUU02_RS13230 (NUU02_13230) | 2683324..2684712 | - | 1389 | WP_003567677.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13773.03 Da Isoelectric Point: 10.9764
>T253812 WP_003567661.1 NZ_CP102530:c2679513-2679130 [Lacticaseibacillus paracasei subsp. paracasei]
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|