Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-HTH_37 |
Location | 462502..463130 | Replicon | chromosome |
Accession | NZ_CP102530 | ||
Organism | Lacticaseibacillus paracasei subsp. paracasei strain 01 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A806L3G4 |
Locus tag | NUU02_RS02275 | Protein ID | WP_012490993.1 |
Coordinates | 462762..463130 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | NUU02_RS02270 | Protein ID | WP_003583264.1 |
Coordinates | 462502..462762 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUU02_RS02245 (NUU02_02245) | 458393..459136 | + | 744 | WP_012490990.1 | SDR family oxidoreductase | - |
NUU02_RS02250 (NUU02_02250) | 459249..459875 | + | 627 | WP_003577713.1 | flavodoxin | - |
NUU02_RS02255 (NUU02_02255) | 460126..460629 | + | 504 | WP_012490991.1 | TetR/AcrR family transcriptional regulator | - |
NUU02_RS02260 (NUU02_02260) | 460634..461695 | + | 1062 | WP_003563374.1 | ABC transporter permease | - |
NUU02_RS02265 (NUU02_02265) | 461700..462389 | + | 690 | WP_012490992.1 | ABC transporter ATP-binding protein | - |
NUU02_RS02270 (NUU02_02270) | 462502..462762 | - | 261 | WP_003583264.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NUU02_RS02275 (NUU02_02275) | 462762..463130 | - | 369 | WP_012490993.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUU02_RS02280 (NUU02_02280) | 463421..464791 | - | 1371 | WP_012490994.1 | FAD-dependent oxidoreductase | - |
NUU02_RS02285 (NUU02_02285) | 465155..465973 | - | 819 | WP_012490995.1 | Cof-type HAD-IIB family hydrolase | - |
NUU02_RS02290 (NUU02_02290) | 466289..466558 | - | 270 | WP_012490996.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
NUU02_RS02295 (NUU02_02295) | 466799..467806 | + | 1008 | WP_003563383.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 14970.02 Da Isoelectric Point: 8.3986
>T253810 WP_012490993.1 NZ_CP102530:c463130-462762 [Lacticaseibacillus paracasei subsp. paracasei]
MYKIDFYEDRDGYSEIEDFLDQLRHSHQKNNVSLLNKITKELYMLQNLGPRLREPHAKFLKGYAYPIMELRPMQERIFYA
AWQKDHFVLLHHYTKKTNKTDHREILRAQSNLEDWLSRKEEN
MYKIDFYEDRDGYSEIEDFLDQLRHSHQKNNVSLLNKITKELYMLQNLGPRLREPHAKFLKGYAYPIMELRPMQERIFYA
AWQKDHFVLLHHYTKKTNKTDHREILRAQSNLEDWLSRKEEN
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|