Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3590258..3590892 | Replicon | chromosome |
| Accession | NZ_CP102514 | ||
| Organism | Streptomyces yangpuensis strain CM253 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NRK68_RS16325 | Protein ID | WP_183066303.1 |
| Coordinates | 3590470..3590892 (+) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NRK68_RS16320 | Protein ID | WP_183066302.1 |
| Coordinates | 3590258..3590473 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NRK68_RS16300 (NRK68_16300) | 3585877..3587130 | - | 1254 | WP_183066300.1 | phosphoribosylamine--glycine ligase | - |
| NRK68_RS16305 (NRK68_16305) | 3587192..3589447 | - | 2256 | WP_257856089.1 | DNA polymerase III subunit gamma and tau | - |
| NRK68_RS16320 (NRK68_16320) | 3590258..3590473 | + | 216 | WP_183066302.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NRK68_RS16325 (NRK68_16325) | 3590470..3590892 | + | 423 | WP_183066303.1 | PIN domain nuclease | Toxin |
| NRK68_RS16330 (NRK68_16330) | 3590972..3591754 | - | 783 | WP_257856090.1 | hypothetical protein | - |
| NRK68_RS16335 (NRK68_16335) | 3591877..3592689 | - | 813 | WP_257856091.1 | VOC family protein | - |
| NRK68_RS16340 (NRK68_16340) | 3592793..3593419 | + | 627 | WP_257857868.1 | HhH-GPD-type base excision DNA repair protein | - |
| NRK68_RS16345 (NRK68_16345) | 3593512..3593985 | + | 474 | WP_183066307.1 | cupin domain-containing protein | - |
| NRK68_RS16350 (NRK68_16350) | 3593934..3594866 | - | 933 | WP_183066308.1 | glucose-6-phosphate dehydrogenase assembly protein OpcA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15569.45 Da Isoelectric Point: 5.1708
>T253807 WP_183066303.1 NZ_CP102514:3590470-3590892 [Streptomyces yangpuensis]
VNAAQFLIDTSALARFMRRDAEQYGWDQAAAAGLIATCPITELEFFYSARSTADRARGIEDMRLIFGWVSVDDRAYDRAW
QVQDALTRQGKHRSAGAVDLVVAATAELQGLTLLHRDHDFECIAAVTGQPLQWYGPEHGK
VNAAQFLIDTSALARFMRRDAEQYGWDQAAAAGLIATCPITELEFFYSARSTADRARGIEDMRLIFGWVSVDDRAYDRAW
QVQDALTRQGKHRSAGAVDLVVAATAELQGLTLLHRDHDFECIAAVTGQPLQWYGPEHGK
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|