Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 4127914..4128478 | Replicon | chromosome |
Accession | NZ_CP102513 | ||
Organism | Streptomyces sp. DSM 40750 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | JIX55_RS18460 | Protein ID | WP_257564407.1 |
Coordinates | 4127914..4128261 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | JIX55_RS18465 | Protein ID | WP_257569375.1 |
Coordinates | 4128248..4128478 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JIX55_RS18445 (JIX55_18445) | 4124580..4125785 | - | 1206 | WP_257564405.1 | hypothetical protein | - |
JIX55_RS18450 (JIX55_18450) | 4125787..4126263 | - | 477 | WP_257569374.1 | sigma-70 family RNA polymerase sigma factor | - |
JIX55_RS18455 (JIX55_18455) | 4126821..4127852 | + | 1032 | WP_257564406.1 | aspartate-semialdehyde dehydrogenase | - |
JIX55_RS18460 (JIX55_18460) | 4127914..4128261 | - | 348 | WP_257564407.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
JIX55_RS18465 (JIX55_18465) | 4128248..4128478 | - | 231 | WP_257569375.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JIX55_RS18470 (JIX55_18470) | 4128579..4131158 | + | 2580 | WP_257564408.1 | aminopeptidase N | - |
JIX55_RS18475 (JIX55_18475) | 4131246..4132217 | - | 972 | WP_257564409.1 | EamA family transporter | - |
JIX55_RS18480 (JIX55_18480) | 4132371..4132907 | + | 537 | WP_257564410.1 | MarR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12504.49 Da Isoelectric Point: 10.3418
>T253806 WP_257564407.1 NZ_CP102513:c4128261-4127914 [Streptomyces sp. DSM 40750]
MKRGDIYLVDYEPARGSEASKARPAVIVSNDGANAAAARTGRGVITLVPLTTNTSRVYPFQVLLPAQECGLPKDSKVQCE
QVRALAPERLLRPIGSVPRQRMAEVDVALRRHLAL
MKRGDIYLVDYEPARGSEASKARPAVIVSNDGANAAAARTGRGVITLVPLTTNTSRVYPFQVLLPAQECGLPKDSKVQCE
QVRALAPERLLRPIGSVPRQRMAEVDVALRRHLAL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|