Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
| Location | 6617674..6618239 | Replicon | chromosome |
| Accession | NZ_CP102512 | ||
| Organism | Streptomyces sp. CA-210063 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | JIX56_RS28955 | Protein ID | WP_257544913.1 |
| Coordinates | 6617871..6618239 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | JIX56_RS28950 | Protein ID | WP_124441851.1 |
| Coordinates | 6617674..6617871 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JIX56_RS28930 (JIX56_28930) | 6612828..6615143 | + | 2316 | WP_257544910.1 | molybdopterin-dependent oxidoreductase | - |
| JIX56_RS28935 (JIX56_28935) | 6615386..6615823 | + | 438 | Protein_5726 | SUKH-4 family immunity protein | - |
| JIX56_RS28945 (JIX56_28945) | 6616169..6617641 | + | 1473 | WP_257544912.1 | MFS transporter | - |
| JIX56_RS28950 (JIX56_28950) | 6617674..6617871 | + | 198 | WP_124441851.1 | hypothetical protein | Antitoxin |
| JIX56_RS28955 (JIX56_28955) | 6617871..6618239 | + | 369 | WP_257544913.1 | Fic family protein | Toxin |
| JIX56_RS28960 (JIX56_28960) | 6618422..6620215 | + | 1794 | WP_257544915.1 | DEAD/DEAH box helicase | - |
| JIX56_RS28965 (JIX56_28965) | 6620546..6621187 | + | 642 | WP_257544917.1 | helix-turn-helix domain-containing protein | - |
| JIX56_RS28970 (JIX56_28970) | 6621265..6622086 | - | 822 | WP_257544918.1 | alpha/beta hydrolase | - |
| JIX56_RS28975 (JIX56_28975) | 6622170..6622646 | + | 477 | WP_257544919.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13736.60 Da Isoelectric Point: 4.8288
>T253805 WP_257544913.1 NZ_CP102512:6617871-6618239 [Streptomyces sp. CA-210063]
MHYLTMPELLNLAQRLGADEVRDYGLLDSALARPQSSVFGQDAYPDVWQKAAALMESLARNHALVDGNKRIAWYATWVYL
HMNGHPLDVDFDVDEAEHFVLDVCQGALDVPKIAAQLPRFAR
MHYLTMPELLNLAQRLGADEVRDYGLLDSALARPQSSVFGQDAYPDVWQKAAALMESLARNHALVDGNKRIAWYATWVYL
HMNGHPLDVDFDVDEAEHFVLDVCQGALDVPKIAAQLPRFAR
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|