Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 5132934..5133501 | Replicon | chromosome |
Accession | NZ_CP102512 | ||
Organism | Streptomyces sp. CA-210063 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | JIX56_RS22270 | Protein ID | WP_257542964.1 |
Coordinates | 5132934..5133215 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JIX56_RS22275 | Protein ID | WP_257542965.1 |
Coordinates | 5133220..5133501 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JIX56_RS22250 (JIX56_22250) | 5128569..5129786 | - | 1218 | WP_257542960.1 | IS1380 family transposase | - |
JIX56_RS22255 (JIX56_22255) | 5129908..5130228 | - | 321 | WP_257542961.1 | hypothetical protein | - |
JIX56_RS22260 (JIX56_22260) | 5130921..5131118 | + | 198 | WP_257542962.1 | hypothetical protein | - |
JIX56_RS22265 (JIX56_22265) | 5131338..5131685 | - | 348 | WP_257542963.1 | DUF1330 domain-containing protein | - |
JIX56_RS22270 (JIX56_22270) | 5132934..5133215 | - | 282 | WP_257542964.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JIX56_RS22275 (JIX56_22275) | 5133220..5133501 | - | 282 | WP_257542965.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JIX56_RS22280 (JIX56_22280) | 5133749..5135836 | - | 2088 | WP_257542966.1 | RICIN domain-containing protein | - |
JIX56_RS22285 (JIX56_22285) | 5136164..5137192 | + | 1029 | WP_257542967.1 | LacI family DNA-binding transcriptional regulator | - |
JIX56_RS22290 (JIX56_22290) | 5137236..5137994 | + | 759 | WP_257542968.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 5128569..5129786 | 1217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10735.40 Da Isoelectric Point: 10.2329
>T253804 WP_257542964.1 NZ_CP102512:c5133215-5132934 [Streptomyces sp. CA-210063]
MGYVTRFTPHAQRDMLKVPRPDALRILYRLTELQKAMDAGDTASFDLKALQGHSARWRLSIGDYRLVHTVEDGQLIVWVL
AVGNRRDIYRQVP
MGYVTRFTPHAQRDMLKVPRPDALRILYRLTELQKAMDAGDTASFDLKALQGHSARWRLSIGDYRLVHTVEDGQLIVWVL
AVGNRRDIYRQVP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|