Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
Location | 5403357..5403922 | Replicon | chromosome |
Accession | NZ_CP102509 | ||
Organism | Streptomyces sp. NBC_00162 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | JIW86_RS25080 | Protein ID | WP_257556137.1 |
Coordinates | 5403551..5403922 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A0M8SFC5 |
Locus tag | JIW86_RS25075 | Protein ID | WP_053702279.1 |
Coordinates | 5403357..5403554 (+) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JIW86_RS25055 (JIW86_25055) | 5398658..5400967 | + | 2310 | WP_257556132.1 | hypothetical protein | - |
JIW86_RS25060 (JIW86_25060) | 5400967..5401506 | + | 540 | WP_257556134.1 | hypothetical protein | - |
JIW86_RS25070 (JIW86_25070) | 5401873..5403324 | + | 1452 | WP_257556136.1 | MFS transporter | - |
JIW86_RS25075 (JIW86_25075) | 5403357..5403554 | + | 198 | WP_053702279.1 | Arc family DNA-binding protein | Antitoxin |
JIW86_RS25080 (JIW86_25080) | 5403551..5403922 | + | 372 | WP_257556137.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
JIW86_RS25085 (JIW86_25085) | 5404052..5405836 | + | 1785 | WP_215144476.1 | DEAD/DEAH box helicase | - |
JIW86_RS25090 (JIW86_25090) | 5406266..5406907 | + | 642 | WP_069920456.1 | helix-turn-helix domain-containing protein | - |
JIW86_RS25095 (JIW86_25095) | 5407122..5407904 | + | 783 | WP_257559434.1 | S16 family serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13740.55 Da Isoelectric Point: 4.6864
>T253803 WP_257556137.1 NZ_CP102509:5403551-5403922 [Streptomyces sp. NBC_00162]
VTHYLTLPEVLNLAERLGTSEVRDYGLLDSALARPQSSVFGQDAYPDIWEKAAALMESLARNHGLVDGNKRIAWYATWVF
LHMNGHPLDADFDVDEAERFVLDVCQGSLDVPKIAAQLPKFAR
VTHYLTLPEVLNLAERLGTSEVRDYGLLDSALARPQSSVFGQDAYPDIWEKAAALMESLARNHGLVDGNKRIAWYATWVF
LHMNGHPLDADFDVDEAERFVLDVCQGSLDVPKIAAQLPKFAR
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|