Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3529817..3530342 | Replicon | chromosome |
Accession | NZ_CP102509 | ||
Organism | Streptomyces sp. NBC_00162 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | JIW86_RS16180 | Protein ID | WP_257554375.1 |
Coordinates | 3530079..3530342 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JIW86_RS16175 | Protein ID | WP_257554373.1 |
Coordinates | 3529817..3530086 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JIW86_RS16140 (JIW86_16140) | 3524874..3525311 | - | 438 | WP_257554362.1 | MarR family transcriptional regulator | - |
JIW86_RS16145 (JIW86_16145) | 3525394..3526383 | + | 990 | WP_257554363.1 | SMP-30/gluconolactonase/LRE family protein | - |
JIW86_RS16150 (JIW86_16150) | 3526483..3526869 | + | 387 | WP_257554364.1 | CPCC family cysteine-rich protein | - |
JIW86_RS16155 (JIW86_16155) | 3526866..3527015 | + | 150 | WP_257554365.1 | hypothetical protein | - |
JIW86_RS16160 (JIW86_16160) | 3527039..3527455 | + | 417 | WP_257554369.1 | HEAT repeat domain-containing protein | - |
JIW86_RS16165 (JIW86_16165) | 3527573..3528163 | - | 591 | WP_257554371.1 | winged helix-turn-helix domain-containing protein | - |
JIW86_RS16170 (JIW86_16170) | 3529032..3529646 | + | 615 | WP_257554372.1 | antibiotic biosynthesis monooxygenase | - |
JIW86_RS16175 (JIW86_16175) | 3529817..3530086 | + | 270 | WP_257554373.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JIW86_RS16180 (JIW86_16180) | 3530079..3530342 | + | 264 | WP_257554375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JIW86_RS16185 (JIW86_16185) | 3530427..3531515 | - | 1089 | WP_257554378.1 | redox-regulated ATPase YchF | - |
JIW86_RS16190 (JIW86_16190) | 3531779..3532168 | + | 390 | WP_251064911.1 | hypothetical protein | - |
JIW86_RS16195 (JIW86_16195) | 3532165..3532944 | - | 780 | WP_257554380.1 | ROK family protein | - |
JIW86_RS16200 (JIW86_16200) | 3532960..3533952 | - | 993 | WP_257554382.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10052.46 Da Isoelectric Point: 9.5565
>T253802 WP_257554375.1 NZ_CP102509:3530079-3530342 [Streptomyces sp. NBC_00162]
VSEYRTAFRPEAQAELRKIPRDMALRVLAKLTELESDPFGFNTTALVSQPERRRLRVGDYRFVYTIDNGELVVWVVHVGH
RSTVYGT
VSEYRTAFRPEAQAELRKIPRDMALRVLAKLTELESDPFGFNTTALVSQPERRRLRVGDYRFVYTIDNGELVVWVVHVGH
RSTVYGT
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|