Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 13006..13649 | Replicon | plasmid pCF10-C |
Accession | NZ_CP102503 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | NUG39_RS25910 | Protein ID | WP_065889659.1 |
Coordinates | 13006..13422 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | NUG39_RS25915 | Protein ID | WP_001261276.1 |
Coordinates | 13419..13649 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS25895 (NUG39_25895) | 8872..10215 | + | 1344 | WP_032192047.1 | APC family permease | - |
NUG39_RS25900 (NUG39_25900) | 11537..12637 | + | 1101 | WP_032192045.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
NUG39_RS25905 (NUG39_25905) | 12725..12970 | - | 246 | WP_045337411.1 | hypothetical protein | - |
NUG39_RS25910 (NUG39_25910) | 13006..13422 | - | 417 | WP_065889659.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUG39_RS25915 (NUG39_25915) | 13419..13649 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NUG39_RS25920 (NUG39_25920) | 14223..14573 | + | 351 | WP_000493378.1 | hypothetical protein | - |
NUG39_RS25930 (NUG39_25930) | 15417..15734 | + | 318 | WP_047345246.1 | DUF305 domain-containing protein | - |
NUG39_RS25935 (NUG39_25935) | 16130..17110 | - | 981 | WP_000019450.1 | IS5-like element ISKpn26 family transposase | - |
NUG39_RS25940 (NUG39_25940) | 17322..18230 | - | 909 | WP_001372261.1 | HNH endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..80740 | 80740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15064.56 Da Isoelectric Point: 8.5403
>T253801 WP_065889659.1 NZ_CP102503:c13422-13006 [Citrobacter youngae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|