Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
Location | 46149..46952 | Replicon | plasmid pCF10-NDM |
Accession | NZ_CP102502 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | W8E895 |
Locus tag | NUG39_RS25325 | Protein ID | WP_016479963.1 |
Coordinates | 46422..46952 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | W8E6Q5 |
Locus tag | NUG39_RS25320 | Protein ID | WP_022652312.1 |
Coordinates | 46149..46418 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS25305 (NUG39_25305) | 42635..42751 | - | 117 | Protein_43 | IS5 family transposase | - |
NUG39_RS25310 (NUG39_25310) | 43269..44008 | + | 740 | Protein_44 | site-specific integrase | - |
NUG39_RS25315 (NUG39_25315) | 44304..45293 | - | 990 | WP_022652311.1 | RepB family plasmid replication initiator protein | - |
NUG39_RS25320 (NUG39_25320) | 46149..46418 | + | 270 | WP_022652312.1 | DUF1778 domain-containing protein | Antitoxin |
NUG39_RS25325 (NUG39_25325) | 46422..46952 | + | 531 | WP_016479963.1 | GNAT family N-acetyltransferase | Toxin |
NUG39_RS25330 (NUG39_25330) | 47120..48100 | + | 981 | WP_000019403.1 | IS5-like element IS5 family transposase | - |
NUG39_RS25335 (NUG39_25335) | 48247..48993 | - | 747 | Protein_49 | IS3 family transposase | - |
NUG39_RS25340 (NUG39_25340) | 49006..49125 | - | 120 | Protein_50 | IS30 family transposase | - |
NUG39_RS25345 (NUG39_25345) | 49380..49562 | - | 183 | WP_016479964.1 | hypothetical protein | - |
NUG39_RS25350 (NUG39_25350) | 49751..51391 | - | 1641 | WP_004201176.1 | chaperonin GroEL | - |
NUG39_RS25355 (NUG39_25355) | 51447..51737 | - | 291 | WP_004201172.1 | co-chaperone GroES | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaNDM-1 | htpB | 1..138196 | 138196 | |
- | inside | IScluster/Tn | - | - | 40668..48912 | 8244 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20350.24 Da Isoelectric Point: 6.4907
>T253799 WP_016479963.1 NZ_CP102502:46422-46952 [Citrobacter youngae]
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTREDKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTREDKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C0L7Q2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2Z3XDS5 |