Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 37363..37888 | Replicon | plasmid pCF10-NDM |
Accession | NZ_CP102502 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | W8EAA6 |
Locus tag | NUG39_RS25275 | Protein ID | WP_008322213.1 |
Coordinates | 37583..37888 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A6C0NE25 |
Locus tag | NUG39_RS25270 | Protein ID | WP_032934863.1 |
Coordinates | 37363..37581 (+) | Length | 73 a.a. |
Genomic Context
Location: 32662..32919 (258 bp)
Type: Others
Protein ID: WP_001567333.1
Type: Others
Protein ID: WP_001567333.1
Location: 33864..34790 (927 bp)
Type: Others
Protein ID: WP_257749362.1
Type: Others
Protein ID: WP_257749362.1
Location: 34787..36595 (1809 bp)
Type: Others
Protein ID: WP_032413492.1
Type: Others
Protein ID: WP_032413492.1
Location: 37363..37581 (219 bp)
Type: Antitoxin
Protein ID: WP_032934863.1
Type: Antitoxin
Protein ID: WP_032934863.1
Location: 37583..37888 (306 bp)
Type: Toxin
Protein ID: WP_008322213.1
Type: Toxin
Protein ID: WP_008322213.1
Location: 37890..38204 (315 bp)
Type: Others
Protein ID: WP_008322211.1
Type: Others
Protein ID: WP_008322211.1
Location: 38194..38985 (792 bp)
Type: Others
Protein ID: WP_008322208.1
Type: Others
Protein ID: WP_008322208.1
Location: 33101..33850 (750 bp)
Type: Others
Protein ID: Protein_33
Type: Others
Protein ID: Protein_33
Location: 39184..40524 (1341 bp)
Type: Others
Protein ID: Protein_40
Type: Others
Protein ID: Protein_40
Location: 40668..41414 (747 bp)
Type: Others
Protein ID: Protein_41
Type: Others
Protein ID: Protein_41
Location: 42635..42751 (117 bp)
Type: Others
Protein ID: Protein_43
Type: Others
Protein ID: Protein_43
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS25250 (NUG39_25250) | 32662..32919 | + | 258 | WP_001567333.1 | hypothetical protein | - |
NUG39_RS25255 (NUG39_25255) | 33101..33850 | - | 750 | Protein_33 | IS110-like element IS4321 family transposase | - |
NUG39_RS25260 (NUG39_25260) | 33864..34790 | + | 927 | WP_257749362.1 | SIR2 family protein | - |
NUG39_RS25265 (NUG39_25265) | 34787..36595 | + | 1809 | WP_032413492.1 | ATP-binding protein | - |
NUG39_RS25270 (NUG39_25270) | 37363..37581 | + | 219 | WP_032934863.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NUG39_RS25275 (NUG39_25275) | 37583..37888 | + | 306 | WP_008322213.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NUG39_RS25280 (NUG39_25280) | 37890..38204 | + | 315 | WP_008322211.1 | hypothetical protein | - |
NUG39_RS25285 (NUG39_25285) | 38194..38985 | + | 792 | WP_008322208.1 | site-specific integrase | - |
NUG39_RS25290 (NUG39_25290) | 39184..40524 | - | 1341 | Protein_40 | GntP family transporter | - |
NUG39_RS25295 (NUG39_25295) | 40668..41414 | - | 747 | Protein_41 | IS5-like element IS5 family transposase | - |
NUG39_RS25305 (NUG39_25305) | 42635..42751 | - | 117 | Protein_43 | IS5 family transposase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaNDM-1 | htpB | 1..138196 | 138196 | |
- | flank | IS/Tn | - | - | 33101..33790 | 689 | |
- | inside | IScluster/Tn | - | - | 40668..48912 | 8244 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11450.23 Da Isoelectric Point: 5.8211
>T253798 WP_008322213.1 NZ_CP102502:37583-37888 [Citrobacter youngae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI
Download Length: 306 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C0NE27 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C0NE25 |