Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 37363..37888 Replicon plasmid pCF10-NDM
Accession NZ_CP102502
Organism Citrobacter youngae strain CF10

Toxin (Protein)


Gene name ccdB Uniprot ID W8EAA6
Locus tag NUG39_RS25275 Protein ID WP_008322213.1
Coordinates 37583..37888 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A6C0NE25
Locus tag NUG39_RS25270 Protein ID WP_032934863.1
Coordinates 37363..37581 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG39_RS25250 (NUG39_25250) 32662..32919 + 258 WP_001567333.1 hypothetical protein -
NUG39_RS25255 (NUG39_25255) 33101..33850 - 750 Protein_33 IS110-like element IS4321 family transposase -
NUG39_RS25260 (NUG39_25260) 33864..34790 + 927 WP_257749362.1 SIR2 family protein -
NUG39_RS25265 (NUG39_25265) 34787..36595 + 1809 WP_032413492.1 ATP-binding protein -
NUG39_RS25270 (NUG39_25270) 37363..37581 + 219 WP_032934863.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NUG39_RS25275 (NUG39_25275) 37583..37888 + 306 WP_008322213.1 type II toxin-antitoxin system toxin CcdB Toxin
NUG39_RS25280 (NUG39_25280) 37890..38204 + 315 WP_008322211.1 hypothetical protein -
NUG39_RS25285 (NUG39_25285) 38194..38985 + 792 WP_008322208.1 site-specific integrase -
NUG39_RS25290 (NUG39_25290) 39184..40524 - 1341 Protein_40 GntP family transporter -
NUG39_RS25295 (NUG39_25295) 40668..41414 - 747 Protein_41 IS5-like element IS5 family transposase -
NUG39_RS25305 (NUG39_25305) 42635..42751 - 117 Protein_43 IS5 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaNDM-1 htpB 1..138196 138196
- flank IS/Tn - - 33101..33790 689
- inside IScluster/Tn - - 40668..48912 8244


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11450.23 Da        Isoelectric Point: 5.8211

>T253798 WP_008322213.1 NZ_CP102502:37583-37888 [Citrobacter youngae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLVSARLLSDKVSRELYPVVSVGGDPYRLMTTDMASVPATVIGEEV
ADLSHLENDIQNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8297.11 Da        Isoelectric Point: 4.4013

>AT253798 WP_032934863.1 NZ_CP102502:37363-37581 [Citrobacter youngae]
VKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C0NE27

Antitoxin

Source ID Structure
AlphaFold DB A0A6C0NE25

References