Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 5864..6389 | Replicon | plasmid pCF10-NDM |
Accession | NZ_CP102502 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A6S4YF27 |
Locus tag | NUG39_RS25125 | Protein ID | WP_025714517.1 |
Coordinates | 5864..6169 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | NUG39_RS25130 | Protein ID | WP_001568025.1 |
Coordinates | 6171..6389 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS25095 (NUG39_25095) | 1543..2169 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
NUG39_RS25100 (NUG39_25100) | 2166..2468 | + | 303 | WP_071571079.1 | hypothetical protein | - |
NUG39_RS25105 (NUG39_25105) | 2940..3734 | - | 795 | WP_004197635.1 | site-specific integrase | - |
NUG39_RS25110 (NUG39_25110) | 3932..4948 | - | 1017 | WP_017899884.1 | hypothetical protein | - |
NUG39_RS25115 (NUG39_25115) | 4959..5273 | - | 315 | WP_053389906.1 | hypothetical protein | - |
NUG39_RS25120 (NUG39_25120) | 5300..5695 | - | 396 | WP_017899885.1 | hypothetical protein | - |
NUG39_RS25125 (NUG39_25125) | 5864..6169 | - | 306 | WP_025714517.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NUG39_RS25130 (NUG39_25130) | 6171..6389 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NUG39_RS25135 (NUG39_25135) | 6969..7538 | + | 570 | WP_016162066.1 | hypothetical protein | - |
NUG39_RS25140 (NUG39_25140) | 7679..8707 | + | 1029 | WP_001568023.1 | Abi family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaNDM-1 | htpB | 1..138196 | 138196 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11562.25 Da Isoelectric Point: 5.6906
>T253797 WP_025714517.1 NZ_CP102502:c6169-5864 [Citrobacter youngae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6S4YF27 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |