Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 120277..121013 | Replicon | plasmid pCF10-tmexCD1 |
| Accession | NZ_CP102501 | ||
| Organism | Citrobacter youngae strain CF10 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A7I6S3M8 |
| Locus tag | NUG39_RS24670 | Protein ID | WP_035896699.1 |
| Coordinates | 120531..121013 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7I6S5M8 |
| Locus tag | NUG39_RS24665 | Protein ID | WP_035896700.1 |
| Coordinates | 120277..120543 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG39_RS24640 (NUG39_24640) | 115671..116879 | - | 1209 | WP_001339197.1 | IS4-like element ISVsa5 family transposase | - |
| NUG39_RS24645 (NUG39_24645) | 116819..117643 | - | 825 | WP_257749344.1 | hypothetical protein | - |
| NUG39_RS24650 (NUG39_24650) | 117662..118621 | - | 960 | WP_257749345.1 | hypothetical protein | - |
| NUG39_RS24660 (NUG39_24660) | 119556..119702 | - | 147 | WP_227675002.1 | hypothetical protein | - |
| NUG39_RS24665 (NUG39_24665) | 120277..120543 | + | 267 | WP_035896700.1 | DUF1778 domain-containing protein | Antitoxin |
| NUG39_RS24670 (NUG39_24670) | 120531..121013 | + | 483 | WP_035896699.1 | GNAT family N-acetyltransferase | Toxin |
| NUG39_RS24675 (NUG39_24675) | 121220..122566 | + | 1347 | WP_257749353.1 | ISNCY family transposase | - |
| NUG39_RS24680 (NUG39_24680) | 122615..123013 | + | 399 | WP_047665785.1 | helix-turn-helix domain-containing protein | - |
| NUG39_RS24685 (NUG39_24685) | 123156..123908 | - | 753 | Protein_120 | IS3-like element ISKpn38 family transposase | - |
| NUG39_RS24690 (NUG39_24690) | 123972..124940 | - | 969 | WP_220439822.1 | IS5 family transposase | - |
| NUG39_RS24695 (NUG39_24695) | 125050..125337 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
| NUG39_RS24700 (NUG39_24700) | 125337..125576 | - | 240 | WP_204628246.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| NUG39_RS24705 (NUG39_24705) | 125601..125702 | + | 102 | Protein_124 | protein YdfV | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-1B / mph(A) / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 / qnrS1 | - | 1..212154 | 212154 | |
| - | inside | IScluster/Tn | mph(A) / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 109958..152463 | 42505 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T253795 WP_035896699.1 NZ_CP102501:120531-121013 [Citrobacter youngae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAYHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAYHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7I6S3M8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7I6S5M8 |