253795

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 120277..121013 Replicon plasmid pCF10-tmexCD1
Accession NZ_CP102501
Organism Citrobacter youngae strain CF10

Toxin (Protein)


Gene name tacT Uniprot ID A0A7I6S3M8
Locus tag NUG39_RS24670 Protein ID WP_035896699.1
Coordinates 120531..121013 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID A0A7I6S5M8
Locus tag NUG39_RS24665 Protein ID WP_035896700.1
Coordinates 120277..120543 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUG39_RS24640 (NUG39_24640) 115671..116879 - 1209 WP_001339197.1 IS4-like element ISVsa5 family transposase -
NUG39_RS24645 (NUG39_24645) 116819..117643 - 825 WP_257749344.1 hypothetical protein -
NUG39_RS24650 (NUG39_24650) 117662..118621 - 960 WP_257749345.1 hypothetical protein -
NUG39_RS24660 (NUG39_24660) 119556..119702 - 147 WP_227675002.1 hypothetical protein -
NUG39_RS24665 (NUG39_24665) 120277..120543 + 267 WP_035896700.1 DUF1778 domain-containing protein Antitoxin
NUG39_RS24670 (NUG39_24670) 120531..121013 + 483 WP_035896699.1 GNAT family N-acetyltransferase Toxin
NUG39_RS24675 (NUG39_24675) 121220..122566 + 1347 WP_257749353.1 ISNCY family transposase -
NUG39_RS24680 (NUG39_24680) 122615..123013 + 399 WP_047665785.1 helix-turn-helix domain-containing protein -
NUG39_RS24685 (NUG39_24685) 123156..123908 - 753 Protein_120 IS3-like element ISKpn38 family transposase -
NUG39_RS24690 (NUG39_24690) 123972..124940 - 969 WP_220439822.1 IS5 family transposase -
NUG39_RS24695 (NUG39_24695) 125050..125337 - 288 WP_000323025.1 type II toxin-antitoxin system mRNA interferase RelE -
NUG39_RS24700 (NUG39_24700) 125337..125576 - 240 WP_204628246.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
NUG39_RS24705 (NUG39_24705) 125601..125702 + 102 Protein_124 protein YdfV -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / mph(A) / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 / qnrS1 - 1..212154 212154
- inside IScluster/Tn mph(A) / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 - 109958..152463 42505


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(46-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17280.93 Da        Isoelectric Point: 8.7197

>T253795 WP_035896699.1 NZ_CP102501:120531-121013 [Citrobacter youngae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAYHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10173.63 Da        Isoelectric Point: 4.5256

>AT253795 WP_035896700.1 NZ_CP102501:120277-120543 [Citrobacter youngae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPPINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7I6S3M8

Antitoxin

Source ID Structure
AlphaFold DB A0A7I6S5M8

References