Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4833353..4833969 | Replicon | chromosome |
Accession | NZ_CP102500 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NUG39_RS23225 | Protein ID | WP_101741972.1 |
Coordinates | 4833353..4833727 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A923DW40 |
Locus tag | NUG39_RS23230 | Protein ID | WP_005121822.1 |
Coordinates | 4833727..4833969 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS23210 (4830856) | 4830856..4831758 | + | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
NUG39_RS23215 (4831755) | 4831755..4832390 | + | 636 | WP_043018888.1 | formate dehydrogenase cytochrome b556 subunit | - |
NUG39_RS23220 (4832387) | 4832387..4833316 | + | 930 | WP_257748514.1 | formate dehydrogenase accessory protein FdhE | - |
NUG39_RS23225 (4833353) | 4833353..4833727 | - | 375 | WP_101741972.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUG39_RS23230 (4833727) | 4833727..4833969 | - | 243 | WP_005121822.1 | CopG family transcriptional regulator | Antitoxin |
NUG39_RS23235 (4834174) | 4834174..4835103 | + | 930 | WP_257748517.1 | alpha/beta hydrolase | - |
NUG39_RS23240 (4835189) | 4835189..4835500 | + | 312 | WP_115601211.1 | type II toxin-antitoxin system HigB family toxin | - |
NUG39_RS23245 (4835497) | 4835497..4835943 | + | 447 | WP_048214030.1 | helix-turn-helix domain-containing protein | - |
NUG39_RS23250 (4835955) | 4835955..4836896 | - | 942 | WP_048214031.1 | fatty acid biosynthesis protein FabY | - |
NUG39_RS23255 (4836941) | 4836941..4837378 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
NUG39_RS23260 (4837375) | 4837375..4838247 | - | 873 | WP_116361127.1 | virulence factor BrkB family protein | - |
NUG39_RS23265 (4838241) | 4838241..4838840 | - | 600 | WP_101741977.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13708.86 Da Isoelectric Point: 9.5622
>T253792 WP_101741972.1 NZ_CP102500:c4833727-4833353 [Citrobacter youngae]
MVKGSALFDTNILIDLFSGRSEAKQAIETWPPQNAISLITWMEVMVGAKKYHQESRTRVALSAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRSEAKQAIETWPPQNAISLITWMEVMVGAKKYHQESRTRVALSAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|