Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 4686776..4687364 | Replicon | chromosome |
Accession | NZ_CP102500 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NUG39_RS22550 | Protein ID | WP_257749332.1 |
Coordinates | 4686776..4687093 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NUG39_RS22555 | Protein ID | WP_048213961.1 |
Coordinates | 4687086..4687364 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS22515 (4682555) | 4682555..4683367 | + | 813 | WP_257748462.1 | shikimate 5-dehydrogenase | - |
NUG39_RS22520 (4683401) | 4683401..4683718 | - | 318 | WP_257748463.1 | CcdB family protein | - |
NUG39_RS22525 (4683718) | 4683718..4684011 | - | 294 | WP_032947883.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
NUG39_RS22530 (4684108) | 4684108..4684473 | - | 366 | WP_137376781.1 | hypothetical protein | - |
NUG39_RS22535 (4684615) | 4684615..4684776 | + | 162 | WP_003841416.1 | phage protein | - |
NUG39_RS22540 (4685214) | 4685214..4685564 | + | 351 | WP_257748464.1 | hypothetical protein | - |
NUG39_RS22545 (4685659) | 4685659..4686219 | + | 561 | WP_257748466.1 | hypothetical protein | - |
NUG39_RS22550 (4686776) | 4686776..4687093 | + | 318 | WP_257749332.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUG39_RS22555 (4687086) | 4687086..4687364 | + | 279 | WP_048213961.1 | putative addiction module antidote protein | Antitoxin |
NUG39_RS22560 (4687464) | 4687464..4688153 | + | 690 | WP_003841421.1 | dipeptidase PepE | - |
NUG39_RS22565 (4688282) | 4688282..4689910 | - | 1629 | WP_257748468.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11984.85 Da Isoelectric Point: 9.8851
>T253791 WP_257749332.1 NZ_CP102500:4686776-4687093 [Citrobacter youngae]
IMEILQTTVFQRWEQNLRDRRAKTLIAARLFRLANGLAGDVKPVGEGVSEMRISYGPGYRIYFKQHGCRIIILLCGGDKS
SQANDITLAKVLARSLDYQETFRHE
IMEILQTTVFQRWEQNLRDRRAKTLIAARLFRLANGLAGDVKPVGEGVSEMRISYGPGYRIYFKQHGCRIIILLCGGDKS
SQANDITLAKVLARSLDYQETFRHE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|