Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4432132..4432648 | Replicon | chromosome |
| Accession | NZ_CP102500 | ||
| Organism | Citrobacter youngae strain CF10 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0D7LMW6 |
| Locus tag | NUG39_RS21340 | Protein ID | WP_003839578.1 |
| Coordinates | 4432132..4432416 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A0J1MV10 |
| Locus tag | NUG39_RS21345 | Protein ID | WP_003839576.1 |
| Coordinates | 4432406..4432648 (-) | Length | 81 a.a. |
Genomic Context
Location: 4427358..4429010 (1653 bp)
Type: Others
Protein ID: WP_257748406.1
Type: Others
Protein ID: WP_257748406.1
Location: 4429419..4431557 (2139 bp)
Type: Others
Protein ID: WP_048212844.1
Type: Others
Protein ID: WP_048212844.1
Location: 4431664..4432128 (465 bp)
Type: Others
Protein ID: WP_048212845.1
Type: Others
Protein ID: WP_048212845.1
Location: 4432132..4432416 (285 bp)
Type: Toxin
Protein ID: WP_003839578.1
Type: Toxin
Protein ID: WP_003839578.1
Location: 4432406..4432648 (243 bp)
Type: Antitoxin
Protein ID: WP_003839576.1
Type: Antitoxin
Protein ID: WP_003839576.1
Location: 4432726..4434639 (1914 bp)
Type: Others
Protein ID: WP_257748410.1
Type: Others
Protein ID: WP_257748410.1
Location: 4434661..4435401 (741 bp)
Type: Others
Protein ID: WP_048212847.1
Type: Others
Protein ID: WP_048212847.1
Location: 4435398..4436516 (1119 bp)
Type: Others
Protein ID: WP_116361061.1
Type: Others
Protein ID: WP_116361061.1
Location: 4436500..4437633 (1134 bp)
Type: Others
Protein ID: WP_257748412.1
Type: Others
Protein ID: WP_257748412.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG39_RS21325 (4427358) | 4427358..4429010 | + | 1653 | WP_257748406.1 | alpha,alpha-phosphotrehalase | - |
| NUG39_RS21330 (4429419) | 4429419..4431557 | + | 2139 | WP_048212844.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NUG39_RS21335 (4431664) | 4431664..4432128 | + | 465 | WP_048212845.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NUG39_RS21340 (4432132) | 4432132..4432416 | - | 285 | WP_003839578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUG39_RS21345 (4432406) | 4432406..4432648 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NUG39_RS21350 (4432726) | 4432726..4434639 | - | 1914 | WP_257748410.1 | BglG family transcription antiterminator | - |
| NUG39_RS21355 (4434661) | 4434661..4435401 | - | 741 | WP_048212847.1 | KDGP aldolase family protein | - |
| NUG39_RS21360 (4435398) | 4435398..4436516 | - | 1119 | WP_116361061.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NUG39_RS21365 (4436500) | 4436500..4437633 | - | 1134 | WP_257748412.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.0482
>T253789 WP_003839578.1 NZ_CP102500:c4432416-4432132 [Citrobacter youngae]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7LMW6 |
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1MV10 |