Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeV-yfjZ/CbtA-CbeA |
Location | 4372239..4372962 | Replicon | chromosome |
Accession | NZ_CP102500 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NUG39_RS21045 | Protein ID | WP_257748387.1 |
Coordinates | 4372239..4372559 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | NUG39_RS21050 | Protein ID | WP_105607669.1 |
Coordinates | 4372627..4372962 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS21015 (4368158) | 4368158..4368520 | + | 363 | WP_071667320.1 | endoribonuclease SymE | - |
NUG39_RS21020 (4368757) | 4368757..4369431 | + | 675 | WP_257748384.1 | hypothetical protein | - |
NUG39_RS21025 (4369433) | 4369433..4369780 | + | 348 | WP_257748385.1 | hypothetical protein | - |
NUG39_RS21030 (4369783) | 4369783..4370262 | + | 480 | WP_199946147.1 | type VI secretion system tube protein TssD | - |
NUG39_RS21035 (4370481) | 4370481..4370807 | - | 327 | WP_115601056.1 | DUF1493 family protein | - |
NUG39_RS21040 (4371004) | 4371004..4371876 | + | 873 | WP_257748386.1 | HNH endonuclease | - |
NUG39_RS21045 (4372239) | 4372239..4372559 | - | 321 | WP_257748387.1 | toxin | Toxin |
NUG39_RS21050 (4372627) | 4372627..4372962 | - | 336 | WP_105607669.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NUG39_RS21055 (4372976) | 4372976..4373455 | - | 480 | WP_102217336.1 | DNA repair protein RadC | - |
NUG39_RS21060 (4373467) | 4373467..4373916 | - | 450 | WP_257748388.1 | antirestriction protein | - |
NUG39_RS21065 (4374013) | 4374013..4374252 | - | 240 | WP_097755449.1 | DUF905 domain-containing protein | - |
NUG39_RS21070 (4374328) | 4374328..4374795 | - | 468 | WP_257748389.1 | protein YfjT | - |
NUG39_RS21075 (4374819) | 4374819..4375259 | - | 441 | WP_148369041.1 | hypothetical protein | - |
NUG39_RS21080 (4375259) | 4375259..4375495 | - | 237 | WP_001144029.1 | protein YpjK | - |
NUG39_RS21085 (4375536) | 4375536..4376237 | - | 702 | WP_249642648.1 | WYL domain-containing protein | - |
NUG39_RS21090 (4376454) | 4376454..4377275 | - | 822 | WP_257748390.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12074.86 Da Isoelectric Point: 6.4799
>T253788 WP_257748387.1 NZ_CP102500:c4372559-4372239 [Citrobacter youngae]
MQISTVPATMPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPLHDDAAIKEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFVTAIDILRARRATGLMNK
MQISTVPATMPVSSRLSPVQVWQQLLTYLLEHHYGLTLNDTPLHDDAAIKEHIEAGITLADAVNFLVERYELVRTDRKGF
TWQEQTPFVTAIDILRARRATGLMNK
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|