Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 3920657..3921363 | Replicon | chromosome |
| Accession | NZ_CP102500 | ||
| Organism | Citrobacter youngae strain CF10 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | NUG39_RS18925 | Protein ID | WP_257748251.1 |
| Coordinates | 3920657..3921025 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | NUG39_RS18930 | Protein ID | WP_257748253.1 |
| Coordinates | 3921046..3921363 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG39_RS18910 (3916311) | 3916311..3917399 | + | 1089 | WP_061067354.1 | ABC transporter substrate-binding protein | - |
| NUG39_RS18915 (3917476) | 3917476..3919245 | + | 1770 | WP_005133551.1 | iron ABC transporter permease | - |
| NUG39_RS18920 (3919238) | 3919238..3920308 | + | 1071 | WP_101742737.1 | ABC transporter ATP-binding protein | - |
| NUG39_RS18925 (3920657) | 3920657..3921025 | - | 369 | WP_257748251.1 | toxin | Toxin |
| NUG39_RS18930 (3921046) | 3921046..3921363 | - | 318 | WP_257748253.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NUG39_RS18935 (3921382) | 3921382..3921603 | - | 222 | WP_257748254.1 | DUF987 domain-containing protein | - |
| NUG39_RS18940 (3921612) | 3921612..3922088 | - | 477 | WP_257748255.1 | RadC family protein | - |
| NUG39_RS18945 (3922104) | 3922104..3922562 | - | 459 | WP_257748256.1 | antirestriction protein | - |
| NUG39_RS18950 (3922648) | 3922648..3922884 | - | 237 | WP_257748257.1 | DUF905 domain-containing protein | - |
| NUG39_RS18955 (3922962) | 3922962..3923372 | - | 411 | WP_257748258.1 | hypothetical protein | - |
| NUG39_RS18960 (3923439) | 3923439..3923876 | - | 438 | WP_047028252.1 | hypothetical protein | - |
| NUG39_RS18965 (3923918) | 3923918..3924454 | - | 537 | WP_257748259.1 | DUF4339 domain-containing protein | - |
| NUG39_RS18970 (3924480) | 3924480..3925187 | - | 708 | WP_257748260.1 | DeoR family transcriptional regulator | - |
| NUG39_RS18975 (3925396) | 3925396..3926220 | - | 825 | WP_257748261.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3904807..3952236 | 47429 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13775.00 Da Isoelectric Point: 9.0360
>T253787 WP_257748251.1 NZ_CP102500:c3921025-3920657 [Citrobacter youngae]
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTTTDILQARKACGLMSRYSYREVSNIVLSRSRL
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDAGITLANAVNFLVEKYELVRIDRNGF
TSQVQAPYLTTTDILQARKACGLMSRYSYREVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|