Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3738743..3739363 | Replicon | chromosome |
| Accession | NZ_CP102500 | ||
| Organism | Citrobacter youngae strain CF10 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NUG39_RS18090 | Protein ID | WP_002892050.1 |
| Coordinates | 3739145..3739363 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | NUG39_RS18085 | Protein ID | WP_003021733.1 |
| Coordinates | 3738743..3739117 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUG39_RS18075 (3733890) | 3733890..3735083 | + | 1194 | WP_200044605.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NUG39_RS18080 (3735106) | 3735106..3738255 | + | 3150 | WP_048212411.1 | efflux RND transporter permease AcrB | - |
| NUG39_RS18085 (3738743) | 3738743..3739117 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| NUG39_RS18090 (3739145) | 3739145..3739363 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NUG39_RS18095 (3739552) | 3739552..3740103 | + | 552 | WP_115600829.1 | maltose O-acetyltransferase | - |
| NUG39_RS18100 (3740220) | 3740220..3740690 | + | 471 | WP_040232692.1 | YlaC family protein | - |
| NUG39_RS18105 (3740768) | 3740768..3740908 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| NUG39_RS18110 (3740910) | 3740910..3741170 | - | 261 | WP_005125189.1 | type B 50S ribosomal protein L31 | - |
| NUG39_RS18115 (3741359) | 3741359..3742912 | + | 1554 | WP_048212413.1 | EAL domain-containing protein | - |
| NUG39_RS18120 (3742967) | 3742967..3743320 | - | 354 | WP_061067436.1 | DUF1428 family protein | - |
| NUG39_RS18125 (3743403) | 3743403..3744014 | - | 612 | WP_061067435.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253786 WP_002892050.1 NZ_CP102500:3739145-3739363 [Citrobacter youngae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT253786 WP_003021733.1 NZ_CP102500:3738743-3739117 [Citrobacter youngae]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |