Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 905668..906322 | Replicon | chromosome |
Accession | NZ_CP102500 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NUG39_RS04430 | Protein ID | WP_048213165.1 |
Coordinates | 905668..906075 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A6N6K0R3 |
Locus tag | NUG39_RS04435 | Protein ID | WP_005123351.1 |
Coordinates | 906056..906322 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS04410 (901569) | 901569..903302 | - | 1734 | WP_257748828.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NUG39_RS04415 (903308) | 903308..904021 | - | 714 | WP_101742745.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NUG39_RS04420 (904045) | 904045..904941 | - | 897 | WP_005123354.1 | site-specific tyrosine recombinase XerD | - |
NUG39_RS04425 (905055) | 905055..905576 | + | 522 | WP_048213164.1 | flavodoxin FldB | - |
NUG39_RS04430 (905668) | 905668..906075 | - | 408 | WP_048213165.1 | protein YgfX | Toxin |
NUG39_RS04435 (906056) | 906056..906322 | - | 267 | WP_005123351.1 | FAD assembly factor SdhE | Antitoxin |
NUG39_RS04440 (906578) | 906578..907558 | + | 981 | WP_048213166.1 | tRNA-modifying protein YgfZ | - |
NUG39_RS04445 (907649) | 907649..908308 | - | 660 | WP_003026947.1 | hemolysin III family protein | - |
NUG39_RS04450 (908472) | 908472..908783 | - | 312 | WP_257748831.1 | N(4)-acetylcytidine aminohydrolase | - |
NUG39_RS04455 (908836) | 908836..909564 | + | 729 | WP_061068520.1 | MurR/RpiR family transcriptional regulator | - |
NUG39_RS04460 (909685) | 909685..911118 | + | 1434 | WP_172743128.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15940.86 Da Isoelectric Point: 10.9468
>T253779 WP_048213165.1 NZ_CP102500:c906075-905668 [Citrobacter youngae]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVCAPWMIKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQQVKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVCAPWMIKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQQVKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|