Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 702322..703001 | Replicon | chromosome |
Accession | NZ_CP102500 | ||
Organism | Citrobacter youngae strain CF10 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A7D6Z078 |
Locus tag | NUG39_RS03470 | Protein ID | WP_048215514.1 |
Coordinates | 702660..703001 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A0F6RHY7 |
Locus tag | NUG39_RS03465 | Protein ID | WP_046495841.1 |
Coordinates | 702322..702639 (+) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUG39_RS03425 (697881) | 697881..698714 | + | 834 | WP_048215513.1 | DUF932 domain-containing protein | - |
NUG39_RS03430 (698916) | 698916..699620 | + | 705 | WP_046495813.1 | WYL domain-containing protein | - |
NUG39_RS03435 (699617) | 699617..700231 | + | 615 | WP_046495819.1 | hypothetical protein | - |
NUG39_RS03440 (700320) | 700320..700730 | + | 411 | WP_257748768.1 | hypothetical protein | - |
NUG39_RS03445 (700808) | 700808..701044 | + | 237 | WP_046495830.1 | DUF905 domain-containing protein | - |
NUG39_RS03450 (701123) | 701123..701581 | + | 459 | WP_046495834.1 | antirestriction protein | - |
NUG39_RS03455 (701597) | 701597..702073 | + | 477 | WP_257748769.1 | RadC family protein | - |
NUG39_RS03460 (702082) | 702082..702303 | + | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
NUG39_RS03465 (702322) | 702322..702639 | + | 318 | WP_046495841.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NUG39_RS03470 (702660) | 702660..703001 | + | 342 | WP_048215514.1 | TA system toxin CbtA family protein | Toxin |
NUG39_RS03475 (703117) | 703117..703950 | + | 834 | WP_046495848.1 | DUF4942 domain-containing protein | - |
NUG39_RS03485 (704253) | 704253..704759 | + | 507 | WP_048213266.1 | G/U mismatch-specific DNA glycosylase | - |
NUG39_RS03490 (704805) | 704805..706652 | - | 1848 | WP_003024699.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 684109..703001 | 18892 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13014.97 Da Isoelectric Point: 10.4182
>T253777 WP_048215514.1 NZ_CP102500:702660-703001 [Citrobacter youngae]
MKPQSAATSRAVKPCLSPVAIWQILLTRLLEQHYGLTLNDTPFRDESVIQEHIDAGITLANAVNFLVEKYELVRIDRRRF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKPQSAATSRAVKPCLSPVAIWQILLTRLLEQHYGLTLNDTPFRDESVIQEHIDAGITLANAVNFLVEKYELVRIDRRRF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D6Z078 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0F6RHY7 |