Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 59031..59767 | Replicon | plasmid pIncFIBK |
Accession | NZ_CP102492 | ||
Organism | Klebsiella pneumoniae strain BA13643 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
Locus tag | LCN95_RS26935 | Protein ID | WP_004187044.1 |
Coordinates | 59031..59513 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | LCN95_RS26940 | Protein ID | WP_003026799.1 |
Coordinates | 59501..59767 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LCN95_RS26915 (LCN95_26920) | 54327..55031 | - | 705 | WP_031591821.1 | toll/interleukin-1 receptor domain-containing protein | - |
LCN95_RS26920 (LCN95_26925) | 55191..56537 | - | 1347 | WP_077251107.1 | ISNCY family transposase | - |
LCN95_RS26925 (LCN95_26930) | 56767..57399 | + | 633 | WP_001567369.1 | hypothetical protein | - |
LCN95_RS26930 (LCN95_26935) | 57428..58831 | - | 1404 | WP_001272054.1 | ISNCY-like element ISKpn21 family transposase | - |
LCN95_RS26935 (LCN95_26940) | 59031..59513 | - | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
LCN95_RS26940 (LCN95_26945) | 59501..59767 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
LCN95_RS26945 (LCN95_26950) | 59918..60622 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
LCN95_RS26950 (LCN95_26955) | 60781..63366 | - | 2586 | WP_004187040.1 | EAL domain-containing protein | - |
LCN95_RS26955 (LCN95_26960) | 63335..63580 | - | 246 | WP_032238678.1 | hypothetical protein | - |
LCN95_RS26960 (LCN95_26965) | 63638..64618 | - | 981 | Protein_64 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | mrkA / mrkB / mrkC / mrkF / mrkJ | 1..112905 | 112905 | |
- | inside | IScluster/Tn | - | - | 50599..64618 | 14019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T253775 WP_004187044.1 NZ_CP102492:c59513-59031 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|