Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4762124..4762640 | Replicon | chromosome |
Accession | NZ_CP102490 | ||
Organism | Klebsiella pneumoniae strain BA13643 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | LCN95_RS23055 | Protein ID | WP_009486548.1 |
Coordinates | 4762124..4762408 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A331AB37 |
Locus tag | LCN95_RS23060 | Protein ID | WP_019704689.1 |
Coordinates | 4762398..4762640 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LCN95_RS23030 (LCN95_23035) | 4757520..4757783 | - | 264 | WP_020802733.1 | PTS sugar transporter subunit IIB | - |
LCN95_RS23035 (LCN95_23040) | 4757913..4758026 | + | 114 | Protein_4514 | hypothetical protein | - |
LCN95_RS23040 (LCN95_23045) | 4758089..4758832 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
LCN95_RS23045 (LCN95_23050) | 4759189..4761327 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
LCN95_RS23050 (LCN95_23055) | 4761656..4762120 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
LCN95_RS23055 (LCN95_23060) | 4762124..4762408 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LCN95_RS23060 (LCN95_23065) | 4762398..4762640 | - | 243 | WP_019704689.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
LCN95_RS23065 (LCN95_23070) | 4762718..4764628 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
LCN95_RS23070 (LCN95_23075) | 4764651..4765805 | - | 1155 | WP_019704690.1 | lactonase family protein | - |
LCN95_RS23075 (LCN95_23080) | 4765872..4766612 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T253772 WP_009486548.1 NZ_CP102490:c4762408-4762124 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331AB37 |