Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4029127..4029746 | Replicon | chromosome |
Accession | NZ_CP102490 | ||
Organism | Klebsiella pneumoniae strain BA13643 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | LCN95_RS19575 | Protein ID | WP_002892050.1 |
Coordinates | 4029528..4029746 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | LCN95_RS19570 | Protein ID | WP_002892066.1 |
Coordinates | 4029127..4029501 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LCN95_RS19560 (LCN95_19565) | 4024279..4025472 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LCN95_RS19565 (LCN95_19570) | 4025495..4028641 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
LCN95_RS19570 (LCN95_19575) | 4029127..4029501 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
LCN95_RS19575 (LCN95_19580) | 4029528..4029746 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
LCN95_RS19580 (LCN95_19585) | 4029905..4030471 | + | 567 | WP_267272241.1 | maltose O-acetyltransferase | - |
LCN95_RS19585 (LCN95_19590) | 4030443..4030583 | - | 141 | WP_032409038.1 | hypothetical protein | - |
LCN95_RS19590 (LCN95_19595) | 4030604..4031074 | + | 471 | WP_002892026.1 | YlaC family protein | - |
LCN95_RS19595 (LCN95_19600) | 4031049..4032499 | - | 1451 | Protein_3843 | PLP-dependent aminotransferase family protein | - |
LCN95_RS19600 (LCN95_19605) | 4032600..4033298 | + | 699 | WP_019705329.1 | GNAT family protein | - |
LCN95_RS19605 (LCN95_19610) | 4033295..4033435 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
LCN95_RS19610 (LCN95_19615) | 4033435..4033698 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253770 WP_002892050.1 NZ_CP102490:4029528-4029746 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT253770 WP_002892066.1 NZ_CP102490:4029127-4029501 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |