Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4029127..4029746 Replicon chromosome
Accession NZ_CP102490
Organism Klebsiella pneumoniae strain BA13643

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag LCN95_RS19575 Protein ID WP_002892050.1
Coordinates 4029528..4029746 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag LCN95_RS19570 Protein ID WP_002892066.1
Coordinates 4029127..4029501 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LCN95_RS19560 (LCN95_19565) 4024279..4025472 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
LCN95_RS19565 (LCN95_19570) 4025495..4028641 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
LCN95_RS19570 (LCN95_19575) 4029127..4029501 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
LCN95_RS19575 (LCN95_19580) 4029528..4029746 + 219 WP_002892050.1 HHA domain-containing protein Toxin
LCN95_RS19580 (LCN95_19585) 4029905..4030471 + 567 WP_267272241.1 maltose O-acetyltransferase -
LCN95_RS19585 (LCN95_19590) 4030443..4030583 - 141 WP_032409038.1 hypothetical protein -
LCN95_RS19590 (LCN95_19595) 4030604..4031074 + 471 WP_002892026.1 YlaC family protein -
LCN95_RS19595 (LCN95_19600) 4031049..4032499 - 1451 Protein_3843 PLP-dependent aminotransferase family protein -
LCN95_RS19600 (LCN95_19605) 4032600..4033298 + 699 WP_019705329.1 GNAT family protein -
LCN95_RS19605 (LCN95_19610) 4033295..4033435 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
LCN95_RS19610 (LCN95_19615) 4033435..4033698 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T253770 WP_002892050.1 NZ_CP102490:4029528-4029746 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT253770 WP_002892066.1 NZ_CP102490:4029127-4029501 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References