Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 785180..785837 | Replicon | chromosome |
Accession | NZ_CP102490 | ||
Organism | Klebsiella pneumoniae strain BA13643 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | LCN95_RS03900 | Protein ID | WP_002916310.1 |
Coordinates | 785427..785837 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | LCN95_RS03895 | Protein ID | WP_002916312.1 |
Coordinates | 785180..785446 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LCN95_RS03870 (LCN95_03870) | 780388..781821 | - | 1434 | WP_267272298.1 | 6-phospho-beta-glucosidase BglA | - |
LCN95_RS03875 (LCN95_03875) | 781940..782668 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
LCN95_RS03880 (LCN95_03880) | 782718..783029 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
LCN95_RS03885 (LCN95_03885) | 783193..783852 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
LCN95_RS03890 (LCN95_03890) | 783951..784934 | - | 984 | WP_016530681.1 | tRNA-modifying protein YgfZ | - |
LCN95_RS03895 (LCN95_03895) | 785180..785446 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
LCN95_RS03900 (LCN95_03900) | 785427..785837 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
LCN95_RS03905 (LCN95_03905) | 785844..786365 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
LCN95_RS03910 (LCN95_03910) | 786466..787362 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
LCN95_RS03915 (LCN95_03915) | 787385..788098 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LCN95_RS03920 (LCN95_03920) | 788104..789837 | + | 1734 | WP_019704911.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T253763 WP_002916310.1 NZ_CP102490:785427-785837 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |