Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 53223..53748 | Replicon | plasmid p113Kb |
Accession | NZ_CP102489 | ||
Organism | Escherichia coli O15:H18 strain ST69 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | NUI00_RS26130 | Protein ID | WP_001159871.1 |
Coordinates | 53443..53748 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | Q3ZU16 |
Locus tag | NUI00_RS26125 | Protein ID | WP_000813639.1 |
Coordinates | 53223..53441 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUI00_RS26120 (49541) | 49541..52672 | + | 3132 | WP_115763486.1 | hypothetical protein | - |
NUI00_RS26125 (53223) | 53223..53441 | + | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NUI00_RS26130 (53443) | 53443..53748 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NUI00_RS26135 (53749) | 53749..54555 | + | 807 | WP_001774328.1 | site-specific integrase | - |
NUI00_RS26140 (55417) | 55417..56171 | + | 755 | Protein_36 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | iroN / iroE / iroD / iroC / iroB | 1..113589 | 113589 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T253760 WP_001159871.1 NZ_CP102489:53443-53748 [Escherichia coli O15:H18]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9DIR5 |