Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 53223..53748 | Replicon | plasmid p113Kb |
| Accession | NZ_CP102489 | ||
| Organism | Escherichia coli O15:H18 strain ST69 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | NUI00_RS26130 | Protein ID | WP_001159871.1 |
| Coordinates | 53443..53748 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | Q3ZU16 |
| Locus tag | NUI00_RS26125 | Protein ID | WP_000813639.1 |
| Coordinates | 53223..53441 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUI00_RS26120 (49541) | 49541..52672 | + | 3132 | WP_115763486.1 | hypothetical protein | - |
| NUI00_RS26125 (53223) | 53223..53441 | + | 219 | WP_000813639.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NUI00_RS26130 (53443) | 53443..53748 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NUI00_RS26135 (53749) | 53749..54555 | + | 807 | WP_001774328.1 | site-specific integrase | - |
| NUI00_RS26140 (55417) | 55417..56171 | + | 755 | Protein_36 | replication initiation protein RepE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iroN / iroE / iroD / iroC / iroB | 1..113589 | 113589 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T253760 WP_001159871.1 NZ_CP102489:53443-53748 [Escherichia coli O15:H18]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9DIR5 |