Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4629164..4629998 Replicon chromosome
Accession NZ_CP102488
Organism Escherichia coli O15:H18 strain ST69

Toxin (Protein)


Gene name yeeV Uniprot ID A0A8E0IX31
Locus tag NUI00_RS22490 Protein ID WP_000854689.1
Coordinates 4629164..4629541 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0IVP8
Locus tag NUI00_RS22495 Protein ID WP_001285599.1
Coordinates 4629618..4629998 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUI00_RS22460 (4625558) 4625558..4625728 - 171 Protein_4387 IS110 family transposase -
NUI00_RS22465 (4626145) 4626145..4627078 - 934 Protein_4388 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
NUI00_RS22470 (4627071) 4627071..4627466 - 396 WP_000208382.1 DUF6088 family protein -
NUI00_RS22475 (4627535) 4627535..4628380 - 846 WP_001446750.1 DUF4942 domain-containing protein -
NUI00_RS22480 (4628465) 4628465..4628662 - 198 WP_000839250.1 DUF957 domain-containing protein -
NUI00_RS22485 (4628679) 4628679..4629167 - 489 WP_000761698.1 DUF5983 family protein -
NUI00_RS22490 (4629164) 4629164..4629541 - 378 WP_000854689.1 TA system toxin CbtA family protein Toxin
NUI00_RS22495 (4629618) 4629618..4629998 - 381 WP_001285599.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NUI00_RS22500 (4630048) 4630048..4630692 - 645 WP_000086757.1 hypothetical protein -
NUI00_RS22505 (4630711) 4630711..4630932 - 222 WP_000692315.1 DUF987 domain-containing protein -
NUI00_RS22510 (4630995) 4630995..4631471 - 477 WP_001186761.1 RadC family protein -
NUI00_RS22515 (4631487) 4631487..4631960 - 474 WP_023351915.1 antirestriction protein -
NUI00_RS22520 (4632224) 4632224..4633045 - 822 WP_099004483.1 DUF932 domain-containing protein -
NUI00_RS22525 (4633224) 4633224..4633313 - 90 WP_225385657.1 DUF905 family protein -
NUI00_RS22530 (4633456) 4633456..4633911 - 456 WP_001309747.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 4625558..4625713 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14042.07 Da        Isoelectric Point: 9.1510

>T253757 WP_000854689.1 NZ_CP102488:c4629541-4629164 [Escherichia coli O15:H18]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13984.78 Da        Isoelectric Point: 5.0823

>AT253757 WP_001285599.1 NZ_CP102488:c4629998-4629618 [Escherichia coli O15:H18]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLLQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References