Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3938080..3938692 | Replicon | chromosome |
Accession | NZ_CP102488 | ||
Organism | Escherichia coli O15:H18 strain ST69 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | NUI00_RS19095 | Protein ID | WP_000833473.1 |
Coordinates | 3938080..3938265 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IWR9 |
Locus tag | NUI00_RS19100 | Protein ID | WP_000499744.1 |
Coordinates | 3938282..3938692 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUI00_RS19085 (3934912) | 3934912..3936063 | + | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
NUI00_RS19090 (3936264) | 3936264..3937802 | + | 1539 | WP_001309845.1 | aldehyde dehydrogenase AldB | - |
NUI00_RS19095 (3938080) | 3938080..3938265 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NUI00_RS19100 (3938282) | 3938282..3938692 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NUI00_RS19105 (3938764) | 3938764..3940728 | - | 1965 | WP_001026861.1 | glycoside hydrolase family 127 protein | - |
NUI00_RS19110 (3940739) | 3940739..3942139 | - | 1401 | WP_000204802.1 | MFS transporter | - |
NUI00_RS19115 (3942365) | 3942365..3943180 | + | 816 | WP_000891825.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T253753 WP_000833473.1 NZ_CP102488:3938080-3938265 [Escherichia coli O15:H18]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT253753 WP_000499744.1 NZ_CP102488:3938282-3938692 [Escherichia coli O15:H18]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|