Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3817050..3817851 | Replicon | chromosome |
| Accession | NZ_CP102488 | ||
| Organism | Escherichia coli O15:H18 strain ST69 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0E0XS49 |
| Locus tag | NUI00_RS18490 | Protein ID | WP_001094437.1 |
| Coordinates | 3817050..3817427 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0E0XTQ1 |
| Locus tag | NUI00_RS18495 | Protein ID | WP_001390338.1 |
| Coordinates | 3817474..3817851 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUI00_RS18460 (3812407) | 3812407..3813330 | - | 924 | WP_000535948.1 | carboxylate/amino acid/amine transporter | - |
| NUI00_RS18465 (3813441) | 3813441..3814625 | - | 1185 | WP_001547040.1 | sugar efflux transporter | - |
| NUI00_RS18470 (3815055) | 3815055..3815183 | - | 129 | Protein_3602 | virulence RhuM family protein | - |
| NUI00_RS18475 (3815419) | 3815419..3816263 | - | 845 | Protein_3603 | DUF4942 domain-containing protein | - |
| NUI00_RS18480 (3816348) | 3816348..3816545 | - | 198 | WP_182557910.1 | hypothetical protein | - |
| NUI00_RS18485 (3816565) | 3816565..3817053 | - | 489 | WP_000761716.1 | DUF5983 family protein | - |
| NUI00_RS18490 (3817050) | 3817050..3817427 | - | 378 | WP_001094437.1 | TA system toxin CbtA family protein | Toxin |
| NUI00_RS18495 (3817474) | 3817474..3817851 | - | 378 | WP_001390338.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NUI00_RS18500 (3818014) | 3818014..3818235 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NUI00_RS18505 (3818298) | 3818298..3818774 | - | 477 | WP_001186775.1 | RadC family protein | - |
| NUI00_RS18510 (3818790) | 3818790..3819263 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| NUI00_RS18515 (3819605) | 3819605..3820423 | - | 819 | WP_001535681.1 | DUF932 domain-containing protein | - |
| NUI00_RS18520 (3820541) | 3820541..3820736 | - | 196 | Protein_3612 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.90 Da Isoelectric Point: 7.3223
>T253752 WP_001094437.1 NZ_CP102488:c3817427-3817050 [Escherichia coli O15:H18]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13745.44 Da Isoelectric Point: 5.0463
>AT253752 WP_001390338.1 NZ_CP102488:c3817851-3817474 [Escherichia coli O15:H18]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYAYLAVYPTPAEPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XS49 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTQ1 |