Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3259527..3260328 | Replicon | chromosome |
| Accession | NZ_CP102488 | ||
| Organism | Escherichia coli O15:H18 strain ST69 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | NUI00_RS15975 | Protein ID | WP_001094436.1 |
| Coordinates | 3259951..3260328 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | NUI00_RS15970 | Protein ID | WP_015953067.1 |
| Coordinates | 3259527..3259904 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUI00_RS15935 (3255439) | 3255439..3256119 | + | 681 | WP_001282927.1 | WYL domain-containing protein | - |
| NUI00_RS15940 (3256267) | 3256267..3256944 | + | 678 | WP_001097312.1 | hypothetical protein | - |
| NUI00_RS15945 (3256950) | 3256950..3257183 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| NUI00_RS15950 (3257273) | 3257273..3258091 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
| NUI00_RS15955 (3258182) | 3258182..3258667 | + | 486 | WP_000860054.1 | antirestriction protein | - |
| NUI00_RS15960 (3258682) | 3258682..3259158 | + | 477 | WP_001186756.1 | RadC family protein | - |
| NUI00_RS15965 (3259227) | 3259227..3259448 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| NUI00_RS15970 (3259527) | 3259527..3259904 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NUI00_RS15975 (3259951) | 3259951..3260328 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| NUI00_RS15980 (3260325) | 3260325..3260813 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| NUI00_RS15985 (3260825) | 3260825..3261022 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| NUI00_RS15990 (3261107) | 3261107..3261952 | + | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
| NUI00_RS15995 (3262023) | 3262023..3263558 | + | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T253750 WP_001094436.1 NZ_CP102488:3259951-3260328 [Escherichia coli O15:H18]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT253750 WP_015953067.1 NZ_CP102488:3259527-3259904 [Escherichia coli O15:H18]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |