Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3150776..3151611 Replicon chromosome
Accession NZ_CP102488
Organism Escherichia coli O15:H18 strain ST69

Toxin (Protein)


Gene name yeeV Uniprot ID A0A836N5J0
Locus tag NUI00_RS15395 Protein ID WP_032198290.1
Coordinates 3151234..3151611 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag NUI00_RS15390 Protein ID WP_001285402.1
Coordinates 3150776..3151144 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUI00_RS15360 (3147413) 3147413..3147868 + 456 WP_000581504.1 IrmA family protein -
NUI00_RS15365 (3147947) 3147947..3148102 + 156 WP_042960768.1 DUF905 family protein -
NUI00_RS15370 (3148271) 3148271..3149089 + 819 WP_115763554.1 DUF932 domain-containing protein -
NUI00_RS15375 (3149352) 3149352..3149831 + 480 WP_028131447.1 antirestriction protein -
NUI00_RS15380 (3149847) 3149847..3150323 + 477 WP_001747787.1 RadC family protein -
NUI00_RS15385 (3150392) 3150392..3150613 + 222 WP_000692323.1 DUF987 domain-containing protein -
NUI00_RS15390 (3150776) 3150776..3151144 + 369 WP_001285402.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NUI00_RS15395 (3151234) 3151234..3151611 + 378 WP_032198290.1 TA system toxin CbtA family protein Toxin
NUI00_RS15400 (3151608) 3151608..3152096 + 489 WP_000761698.1 DUF5983 family protein -
NUI00_RS15405 (3152113) 3152113..3152309 + 197 Protein_3020 hypothetical protein -
NUI00_RS15410 (3152394) 3152394..3153242 + 849 WP_032198269.1 DUF4942 domain-containing protein -
NUI00_RS15415 (3153301) 3153301..3153504 - 204 WP_016234185.1 hypothetical protein -
NUI00_RS15420 (3153514) 3153514..3154164 - 651 WP_000056771.1 3-keto-L-gulonate-6-phosphate decarboxylase UlaD -
NUI00_RS15425 (3154178) 3154178..3154642 - 465 WP_000776521.1 PTS ascorbate transporter subunit IIA -
NUI00_RS15430 (3154652) 3154652..3154957 - 306 WP_000218360.1 PTS ascorbate transporter subunit IIB -
NUI00_RS15435 (3154973) 3154973..3156370 - 1398 WP_001323091.1 PTS ascorbate transporter subunit IIC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13941.93 Da        Isoelectric Point: 8.9948

>T253749 WP_032198290.1 NZ_CP102488:3151234-3151611 [Escherichia coli O15:H18]
MKTLPVLPGQAASSRPSPVEIWQTLLSRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13883.62 Da        Isoelectric Point: 6.3165

>AT253749 WP_001285402.1 NZ_CP102488:3150776-3151144 [Escherichia coli O15:H18]
VSDTHHETNYPDDYNNRPWWGLPCTITPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELILTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A836N5J0

Antitoxin

Source ID Structure

References