Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2270386..2271004 | Replicon | chromosome |
Accession | NZ_CP102488 | ||
Organism | Escherichia coli O15:H18 strain ST69 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NUI00_RS11060 | Protein ID | WP_001291435.1 |
Coordinates | 2270786..2271004 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NUI00_RS11055 | Protein ID | WP_000344800.1 |
Coordinates | 2270386..2270760 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUI00_RS11045 (2265475) | 2265475..2266668 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NUI00_RS11050 (2266691) | 2266691..2269840 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
NUI00_RS11055 (2270386) | 2270386..2270760 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NUI00_RS11060 (2270786) | 2270786..2271004 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NUI00_RS11065 (2271176) | 2271176..2271727 | + | 552 | WP_000102559.1 | maltose O-acetyltransferase | - |
NUI00_RS11070 (2271843) | 2271843..2272313 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NUI00_RS11075 (2272477) | 2272477..2274027 | + | 1551 | WP_001389864.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NUI00_RS11080 (2274069) | 2274069..2274422 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NUI00_RS11090 (2274801) | 2274801..2275112 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NUI00_RS11095 (2275143) | 2275143..2275715 | - | 573 | WP_257739432.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253746 WP_001291435.1 NZ_CP102488:2270786-2271004 [Escherichia coli O15:H18]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT253746 WP_000344800.1 NZ_CP102488:2270386-2270760 [Escherichia coli O15:H18]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |