Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 1810553..1811258 | Replicon | chromosome |
| Accession | NZ_CP102488 | ||
| Organism | Escherichia coli O15:H18 strain ST69 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | NUI00_RS08870 | Protein ID | WP_000539521.1 |
| Coordinates | 1810553..1810939 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NUI00_RS08875 | Protein ID | WP_001280945.1 |
| Coordinates | 1810929..1811258 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUI00_RS08850 (1806557) | 1806557..1807183 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| NUI00_RS08855 (1807180) | 1807180..1808295 | - | 1116 | Protein_1740 | aldose sugar dehydrogenase YliI | - |
| NUI00_RS08860 (1808406) | 1808406..1808789 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| NUI00_RS08865 (1809002) | 1809002..1810327 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| NUI00_RS08870 (1810553) | 1810553..1810939 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUI00_RS08875 (1810929) | 1810929..1811258 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| NUI00_RS08880 (1811328) | 1811328..1812656 | - | 1329 | WP_000086879.1 | GGDEF domain-containing protein | - |
| NUI00_RS08885 (1812664) | 1812664..1815012 | - | 2349 | WP_001322378.1 | EAL domain-containing protein | - |
| NUI00_RS08890 (1815190) | 1815190..1816101 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T253745 WP_000539521.1 NZ_CP102488:1810553-1810939 [Escherichia coli O15:H18]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|