Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1563349..1564133 | Replicon | chromosome |
| Accession | NZ_CP102488 | ||
| Organism | Escherichia coli O15:H18 strain ST69 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | V0T0H9 |
| Locus tag | NUI00_RS07700 | Protein ID | WP_000613626.1 |
| Coordinates | 1563639..1564133 (+) | Length | 165 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | L4JCW6 |
| Locus tag | NUI00_RS07695 | Protein ID | WP_001110447.1 |
| Coordinates | 1563349..1563642 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUI00_RS07685 (1558499) | 1558499..1559458 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
| NUI00_RS07690 (1560031) | 1560031..1563216 | + | 3186 | WP_000827427.1 | ribonuclease E | - |
| NUI00_RS07695 (1563349) | 1563349..1563642 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
| NUI00_RS07700 (1563639) | 1563639..1564133 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
| NUI00_RS07705 (1564228) | 1564228..1565181 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
| NUI00_RS07710 (1565193) | 1565193..1566836 | - | 1644 | WP_000096524.1 | flagellar hook-associated protein FlgK | - |
| NUI00_RS07715 (1566902) | 1566902..1567843 | - | 942 | WP_001309406.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
| NUI00_RS07720 (1567843) | 1567843..1568940 | - | 1098 | WP_000589320.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T253744 WP_000613626.1 NZ_CP102488:1563639-1564133 [Escherichia coli O15:H18]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|