Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 519803..520634 Replicon chromosome
Accession NZ_CP102488
Organism Escherichia coli O15:H18 strain ST69

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NUI00_RS02340 Protein ID WP_000854814.1
Coordinates 519803..520177 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag NUI00_RS02345 Protein ID WP_001285585.1
Coordinates 520266..520634 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUI00_RS02300 (515199) 515199..516365 + 1167 WP_000830150.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
NUI00_RS02305 (516484) 516484..516957 + 474 WP_001105389.1 DNA gyrase inhibitor SbmC -
NUI00_RS02310 (517155) 517155..518213 + 1059 WP_001200891.1 FUSC family protein -
NUI00_RS02315 (518385) 518385..518714 + 330 WP_000450409.1 DUF496 family protein -
NUI00_RS02320 (518815) 518815..518949 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
NUI00_RS02325 (519069) 519069..519197 + 129 Protein_456 transposase domain-containing protein -
NUI00_RS02330 (519486) 519486..519566 - 81 Protein_457 hypothetical protein -
NUI00_RS02335 (519612) 519612..519806 - 195 WP_000988600.1 DUF5983 family protein -
NUI00_RS02340 (519803) 519803..520177 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NUI00_RS02345 (520266) 520266..520634 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NUI00_RS02350 (520708) 520708..520929 - 222 WP_000692323.1 DUF987 domain-containing protein -
NUI00_RS02355 (520992) 520992..521468 - 477 WP_001186726.1 RadC family protein -
NUI00_RS02360 (521484) 521484..521963 - 480 WP_000860087.1 antirestriction protein -
NUI00_RS02365 (522045) 522045..522863 - 819 WP_001234629.1 DUF932 domain-containing protein -
NUI00_RS02370 (522963) 522963..523196 - 234 WP_001119729.1 DUF905 family protein -
NUI00_RS02375 (523275) 523275..523730 - 456 WP_000581504.1 IrmA family protein -
NUI00_RS02380 (523806) 523806..525530 - 1725 Protein_467 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T253736 WP_000854814.1 NZ_CP102488:c520177-519803 [Escherichia coli O15:H18]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT253736 WP_001285585.1 NZ_CP102488:c520634-520266 [Escherichia coli O15:H18]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References