Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 243759..244353 | Replicon | chromosome |
| Accession | NZ_CP102485 | ||
| Organism | Burkholderia contaminans strain DM32 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A228JB64 |
| Locus tag | NTJ56_RS39510 | Protein ID | WP_027811055.1 |
| Coordinates | 244060..244353 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A228JAU5 |
| Locus tag | NTJ56_RS39505 | Protein ID | WP_027811056.1 |
| Coordinates | 243759..244058 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTJ56_RS39485 (NTJ56_39485) | 239057..241123 | - | 2067 | WP_027811059.1 | type IV secretion system DNA-binding domain-containing protein | - |
| NTJ56_RS39490 (NTJ56_39490) | 241116..241517 | - | 402 | WP_027811058.1 | hypothetical protein | - |
| NTJ56_RS39495 (NTJ56_39495) | 242534..243037 | + | 504 | WP_143277545.1 | hypothetical protein | - |
| NTJ56_RS39500 (NTJ56_39500) | 243285..243596 | + | 312 | WP_027811057.1 | hypothetical protein | - |
| NTJ56_RS39505 (NTJ56_39505) | 243759..244058 | - | 300 | WP_027811056.1 | putative addiction module antidote protein | Antitoxin |
| NTJ56_RS39510 (NTJ56_39510) | 244060..244353 | - | 294 | WP_027811055.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NTJ56_RS39515 (NTJ56_39515) | 244458..244601 | - | 144 | WP_154233621.1 | hypothetical protein | - |
| NTJ56_RS39520 (NTJ56_39520) | 244658..244879 | - | 222 | WP_027811054.1 | DUF3717 domain-containing protein | - |
| NTJ56_RS39525 (NTJ56_39525) | 244924..245475 | - | 552 | WP_077186813.1 | hypothetical protein | - |
| NTJ56_RS39530 (NTJ56_39530) | 245450..245716 | - | 267 | WP_027811052.1 | hypothetical protein | - |
| NTJ56_RS39535 (NTJ56_39535) | 246760..248889 | - | 2130 | WP_039350079.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10854.50 Da Isoelectric Point: 10.6086
>T253733 WP_027811055.1 NZ_CP102485:c244353-244060 [Burkholderia contaminans]
MRIEQTDDFAKWLRGLRDHIARAQIAKRIQRLARGQYGDMKPVGAGVSEMRVHVGPGYRVYFVQRGSTLVVLLCGGDKST
QQRDIERAIALSAQLGD
MRIEQTDDFAKWLRGLRDHIARAQIAKRIQRLARGQYGDMKPVGAGVSEMRVHVGPGYRVYFVQRGSTLVVLLCGGDKST
QQRDIERAIALSAQLGD
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A228JB64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A228JAU5 |