Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 166190..166839 Replicon chromosome
Accession NZ_CP102485
Organism Burkholderia contaminans strain DM32

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NTJ56_RS39130 Protein ID WP_027813527.1
Coordinates 166190..166600 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A6P2T8K5
Locus tag NTJ56_RS39135 Protein ID WP_027813526.1
Coordinates 166597..166839 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NTJ56_RS39090 (NTJ56_39090) 161471..162373 - 903 WP_223274428.1 TnsA endonuclease N-terminal domain-containing protein -
NTJ56_RS39095 (NTJ56_39095) 162480..162734 - 255 WP_046544062.1 hypothetical protein -
NTJ56_RS39100 (NTJ56_39100) 162744..162974 - 231 WP_027813533.1 hypothetical protein -
NTJ56_RS39105 (NTJ56_39105) 162985..164070 - 1086 WP_027813532.1 hypothetical protein -
NTJ56_RS39110 (NTJ56_39110) 164115..164420 - 306 WP_027813531.1 hypothetical protein -
NTJ56_RS39115 (NTJ56_39115) 164441..165094 - 654 WP_027813530.1 helix-turn-helix domain-containing protein -
NTJ56_RS39120 (NTJ56_39120) 165282..165482 - 201 WP_034176085.1 hypothetical protein -
NTJ56_RS39125 (NTJ56_39125) 165531..165890 - 360 WP_223274427.1 hypothetical protein -
NTJ56_RS39130 (NTJ56_39130) 166190..166600 - 411 WP_027813527.1 type II toxin-antitoxin system VapC family toxin Toxin
NTJ56_RS39135 (NTJ56_39135) 166597..166839 - 243 WP_027813526.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NTJ56_RS39140 (NTJ56_39140) 166934..167920 - 987 WP_223274426.1 non-homologous end-joining DNA ligase -
NTJ56_RS39145 (NTJ56_39145) 168386..169057 + 672 WP_027813524.1 AAA family ATPase -
NTJ56_RS39150 (NTJ56_39150) 169057..170022 + 966 WP_027813523.1 ParB/RepB/Spo0J family partition protein -
NTJ56_RS39155 (NTJ56_39155) 170765..171622 + 858 WP_027813522.1 plasmid replication initiator TrfA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 159265..243596 84331


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(12-50)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14869.13 Da        Isoelectric Point: 4.8604

>T253732 WP_027813527.1 NZ_CP102485:c166600-166190 [Burkholderia contaminans]
MTLYLLDTNILSNVIRDPRGACATRIGETPPEQVCTSIIVAAELRFGVWKRGSSTLAQRVEQLLASLTVLPLQPDADRCY
GRLRAELEKQGQLIDANDMLIAAHALAVDAVLVTDNTAEFTRIAGLPVENWLRPAT

Download         Length: 411 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9375.64 Da        Isoelectric Point: 4.6856

>AT253732 WP_027813526.1 NZ_CP102485:c166839-166597 [Burkholderia contaminans]
MPNHDTRHARLFRNGRSQAVRIPREFELPVSEVTIHREGRRLIIEPVEAAPLRELFAQWTPLDEIFPDIEDLPPEPVDIE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6P2T8K5

References