Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2649356..2649976 | Replicon | chromosome |
| Accession | NZ_CP102483 | ||
| Organism | Burkholderia contaminans strain DM32 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NTJ56_RS30050 | Protein ID | WP_124471846.1 |
| Coordinates | 2649356..2649673 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1J9PWC2 |
| Locus tag | NTJ56_RS30055 | Protein ID | WP_039344756.1 |
| Coordinates | 2649677..2649976 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTJ56_RS30040 (NTJ56_30040) | 2645900..2647333 | - | 1434 | WP_071332978.1 | aldehyde dehydrogenase family protein | - |
| NTJ56_RS30045 (NTJ56_30045) | 2647363..2649003 | - | 1641 | WP_039344750.1 | acetolactate synthase large subunit | - |
| NTJ56_RS30050 (NTJ56_30050) | 2649356..2649673 | + | 318 | WP_124471846.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NTJ56_RS30055 (NTJ56_30055) | 2649677..2649976 | + | 300 | WP_039344756.1 | putative addiction module antidote protein | Antitoxin |
| NTJ56_RS30060 (NTJ56_30060) | 2650025..2651311 | - | 1287 | WP_226222934.1 | DUF445 domain-containing protein | - |
| NTJ56_RS30065 (NTJ56_30065) | 2651482..2652702 | - | 1221 | WP_226222932.1 | anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase | - |
| NTJ56_RS30070 (NTJ56_30070) | 2652692..2653018 | - | 327 | WP_039344765.1 | anthranilate 1,2-dioxygenase ferredoxin subunit AndAb | - |
| NTJ56_RS30075 (NTJ56_30075) | 2653039..2653527 | - | 489 | WP_069251004.1 | anthranilate 1,2-dioxygenase small subunit AndAd | - |
| NTJ56_RS30080 (NTJ56_30080) | 2653541..2654812 | - | 1272 | WP_226222930.1 | anthranilate 1,2-dioxygenase large subunit AndAc | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11868.59 Da Isoelectric Point: 9.5691
>T253731 WP_124471846.1 NZ_CP102483:2649356-2649673 [Burkholderia contaminans]
MPYSAPTFSIRTTDVFDTWFAGLQDRVAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILL
CGGDKSTQQADIRAAHAMLAHLDME
MPYSAPTFSIRTTDVFDTWFAGLQDRVAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILL
CGGDKSTQQADIRAAHAMLAHLDME
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|